Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR75 IGR72 IGR71 IGR74 IGR70 IGR73 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpB, - CPn0089 atpA, - CPn0088 rpoC, - CPn0082 CPn0087 CPn0087
* Calculated from Protein Sequence

Gene ID: CPn0084

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (possible ferrodoxin)

Gene Start:
103362

Gene Stop:
103754

Gene Length:
393

Molecular Weight*:
14624

pI*:
7.00

Net Charge*:
0.08

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0084 is orthologously related to CT312:
residues 8-123 are 52% similar to residues
5-120 of CT312.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKNKMDYKSQLVFSCPCCCKGNVCFSVFNLDVILTCNVCSSTYTFDSVIR
NEIRQFVALCKRIHDANSILGNATVSVSVEDNQMDIPFQLLFSRFPVVLN
LSLDGKKIAIRFLFDALNTSILHQESDLIS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAATAAGATGGACTATAAATCGCAACTAGTATTTTCTTGCCCTTG
TTGTTGCAAAGGCAATGTTTGTTTCTCAGTTTTTAACTTAGACGTTATTT
TAACATGTAACGTTTGCTCATCTACTTATACATTCGATTCTGTCATACGT
AATGAGATTCGTCAGTTTGTAGCACTATGTAAAAGGATACATGATGCTAA
TTCTATACTTGGAAATGCTACTGTGTCGGTATCGGTAGAAGACAACCAAA
TGGATATTCCCTTTCAATTGCTGTTTTCTCGTTTCCCTGTAGTATTAAAT
CTCTCTTTAGATGGAAAGAAAATAGCTATTCGTTTCCTCTTTGATGCTTT
AAATACAAGTATCTTACACCAAGAAAGCGATCTTATTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy