Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR72 IGR69 IGR71 IGR74 IGR70 IGR73 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpA, - CPn0088 rpoB, - CPn0081 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpA, - CPn0088 rpoB, - CPn0081 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 atpA, - CPn0088 rpoB, - CPn0081 rpoC, - CPn0082 CPn0087 CPn0087
* Calculated from Protein Sequence

Gene ID: CPn0083

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tal  

Definition:
transaldolase

Gene Start:
102332

Gene Stop:
103315

Gene Length:
984

Molecular Weight*:
36038

pI*:
4.80

Net Charge*:
-7.88

EC:
2.2.1.2  

Functional Class:
energy metabolism; pentose phosphate pathway  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle

Comment:

Transaldolase converts sedohetulose 7-phosphate +
D-glyceraldehyde 3-phosphate
to D-erythrose 4-phosphate + D-fructose
6-phosphate as part of the
pentose-phosphate pathway. A 3D structure is
available for the E.coli transaldolase homodimer.


From Prosite PDOC00741:

Transaldolase (EC 2.2.1.2) catalyzes the
reversible transfer of a three-carbon ketol unit
from sedoheptulose 7-phosphate to glyceraldehyde
3-phosphate to form erythrose 4-phosphate and
fructose 6-phosphate. This enzyme, together with
transketolase, provides a link between the
glycolytic and pentose-phosphate pathways.
Transaldolase is an enzyme of about 34 Kd whose
sequence has been well conserved throughout
evolution. A lysine has been implicated in the
catalytic mechanism of the enzyme; it acts as a
nucleophilic group that attacks the carbonyl
group of fructose-6-phosphate.

Transaldolase is evolutionary related to a
bacterial protein of about 20 Kd (known as talC
in Escherichia coli), whose exact function is not
yet known.

Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum.

CPn0083 is orthologously related to CT313 and
they share 81% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 13 to 315 (E-value = 1.1e-112) place CPn0083 in the Transaldolase family which is described as Transaldolase (PF00923)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
152  
170
transmembrane  
175  
192

PDB Hit:


Gene Protein Sequence:
MSNQFDQLKKLSTIVCDSGDPELVKASGSQDATTNPSLILKVAQEPKFQE
LLNEAVVWGIRQNGDDLQTLSFILDKIQVNFALEIIKNIPGRISLEIDAR
LSFNVEAMVQRAVFLSQLFEAMGGDKKRLLVKIPGTWEGIRAVEFLEAKG
IACNVTLIFNLVQAIAAAKAKATLISPFVGRIYDWWIAAYGDEGYSIDAD
PGVASVSNIYAYYKKFGIPTQIMAASFRTKEQVLALAGCDLLTISPKLLD
ELKKSQHPVKKELDPAEAKKLDVQPIELTESFFRFLMNEDAMATEKLAEG
IRIFAGDTQILETAITEFIKQIAAEGA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAACCAATTTGATCAATTAAAGAAGTTGAGCACTATCGTTTGTGA
TAGCGGAGACCCAGAGCTAGTTAAAGCCTCGGGATCTCAAGACGCTACAA
CAAACCCTTCTTTGATCTTAAAAGTGGCCCAAGAACCCAAATTTCAAGAG
CTATTAAACGAAGCTGTAGTTTGGGGAATCCGACAGAACGGTGATGATCT
TCAGACTCTTTCTTTTATTTTAGACAAAATTCAGGTTAACTTTGCTCTAG
AAATTATCAAAAATATCCCTGGTAGAATTTCTCTTGAAATTGACGCTAGG
CTTTCTTTCAACGTTGAAGCTATGGTACAGCGTGCCGTATTCCTTTCGCA
GCTTTTCGAAGCTATGGGAGGAGATAAAAAGCGCCTGTTAGTAAAGATTC
CTGGAACTTGGGAAGGTATTCGAGCTGTTGAATTTTTAGAAGCAAAGGGC
ATAGCATGTAATGTCACTTTGATTTTTAATTTAGTTCAAGCGATTGCAGC
TGCTAAAGCTAAAGCAACTTTAATTTCTCCTTTTGTTGGCCGTATTTATG
ATTGGTGGATCGCGGCTTATGGTGATGAAGGTTACTCTATAGATGCAGAT
CCAGGTGTCGCTTCAGTATCAAATATTTACGCGTATTACAAAAAATTCGG
TATTCCTACGCAAATTATGGCAGCATCTTTTCGTACAAAAGAGCAGGTAC
TAGCATTAGCTGGTTGCGATCTTTTAACGATATCTCCAAAGCTGCTGGAT
GAGCTAAAGAAATCTCAACACCCAGTAAAAAAAGAATTAGATCCTGCAGA
AGCTAAAAAGTTAGATGTGCAGCCAATAGAACTCACAGAAAGCTTTTTTC
GCTTTTTAATGAATGAGGATGCTATGGCTACAGAAAAACTTGCTGAAGGA
ATTCGGATATTTGCAGGAGATACTCAAATTCTTGAGACTGCAATTACAGA
GTTTATAAAGCAAATTGCTGCAGAAGGTGCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy