Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR72 IGR69 IGR71 IGR70 IGR73 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 rpoB, - CPn0081 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 rpoB, - CPn0081 rpoC, - CPn0082 CPn0085 CPn0084 atpE, - CPn0086 tal, - CPn0083 rpoB, - CPn0081 rpoC, - CPn0082
* Calculated from Protein Sequence

Gene ID: CPn0082

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoC  

Definition:
DNA-directed RNA polymerase beta prime chain

Gene Start:
98043

Gene Stop:
102224

Gene Length:
4182

Molecular Weight*:
154891

pI*:
7.20

Net Charge*:
2.42

EC:
2.7.7.6  

Functional Class:
transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0082 is orthologously related to CT314: residues 1-1392 of CPn0082 are 92% similar to residues 1-1394 of CT314, a predicted DNA-directed RNA polymerase beta' subunit.
CPn0082 is also similar to TP0242, UU188, MG340.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralog in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 15 to 345 (E-value = 1.7e-164) place CPn0082 in the RNA_pol_Rpb1_1 family which is described as RNA polymerase Rpb1, domain 1 (PF04997)
Residues 347 to 489 (E-value = 1.8e-86) place CPn0082 in the RNA_pol_Rpb1_2 family which is described as RNA polymerase Rpb1, domain 2 (PF00623)
Residues 492 to 652 (E-value = 5.1e-38) place CPn0082 in the RNA_pol_Rpb1_3 family which is described as RNA polymerase Rpb1, domain 3 (PF04983)
Residues 677 to 762 (E-value = 6.9e-28) place CPn0082 in the RNA_pol_Rpb1_4 family which is described as RNA polymerase Rpb1, domain 4 (PF05000)
Residues 764 to 1323 (E-value = 1.8e-169) place CPn0082 in the RNA_pol_Rpb1_5 family which is described as RNA polymerase Rpb1, domain 5 (PF04998)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
194  
224
non-globular  
1095  
1181

PDB Hit:


Gene Protein Sequence:
MFGENSRDIGVLSKEGLFDKLEIGIASDITIRDKWSCGEIKKPETINYRT
FKPEKGGLFCEKIFGPTKDWECCCGKYKKIKHKGIVCDRCGVEVTLSKVR
RERMAHIELAVPIVHIWFFKTTPSRIGNVLGMTASDLERVIYYEEYVVID
PGKTDLTKKQLLNDAQYREVVEKWGKDAFVAKMGGEAIYDLLKSEDLQSL
LKDLKERLRKTKSQQARMKLAKRLKIIEGFVSSSNHPEWMVLKNIPVVPP
DLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKAILRLKTPEVIVRNEKR
MLQEAVDALFDNGRHGHPVMGAGNRPLKSLSEMLKGKNGRFRQNLLGKRV
DYSGRSVIIVGPELKFNQCGLPKEMALELFEPFIIKRLKDQGSVYTIRSA
KKMIQRGAPEVWDVLEEIIKGHPVLLNRAPTLHRLGIQAFEPVLIEGKAI
RIHPLVCAAFNADFDGDQMAVHVPLSVEAQLEAKVLMMAPDNIFLPSSGK
PVAIPSKDMTLGLYYLMADPTYFPEEHGGKTKIFKDEIEVLRALNNGGFI
DDVFGDRRDETGRGIHIHEKIKVRIDGQIIETTPGRVLFNRIVPKELGFQ
NYSMPSKRISELILQCYKKVGLEATVRFLDDLKDLGFIQATKAAISMGLK
DVRIPDIKSHILKDAYDKVAIVKKQYDDGIITEGERHSKTISIWTEVSEQ
LSDALYVEISKQTRSKHNPLFLMIDSGARGNKSQLKQLGALRGLMAKPNG
AIIESPITSNFREGLTVLEYSISSHGARKGLADTALKTADSGYLTRRLVD
VAQDVIITEKDCGTLNHIEISAIGQGSEELLPLKDRIYGRTVAEDVYQPG
DKSRLLAQSGDVLNSVQAEAIDDAGIETIKIRSTLTCESPRGVCAKCYGL
NLANGRLIGMGEAVGIIAAQSIGEPGTQLTMRTFHLGGIAATSSTPEIIT
NSDGILVYMDLRVVLGQEGHNLVLNKKGALHVVGDEGRTLNEYKKLLSTK
SIESLEVFPVELGVKILVADGTPVSQGQRIGEVELHNIPIICDKPGFIKY
EDLVEGISTEKVVNKNTGLVELIVKQHRGELHPQIAIYDDADLSELVGTY
AIPSGAIISVEEGQRVDPGMLLARLPRGAIKTKDITGGLPRVAELVEARK
PEDAADIAKIDGVVDFKGIQKNKRILVVCDEMTGMEEEHLIPLTKHLIVQ
RGDSVIKGQQLTDGLVVPHEILEICGVRELQKYLVNEVQEVYRLQGVDIN
DKHIEIIVRQMLQKVRITDPGDTTLLFGEDVNKKEFYEENRRTEEDGGKP
AQAVPVLLGITKASLGTESFISAASFQDTTRVLTDAACCSKTDYLLGFKE
NVIMGHMIPGGTGFETHKRIKQYLEKEQEDLVFDFVSETECVC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCGGAGAAAATTCTCGAGACATTGGAGTTCTTTCTAAAGAAGGACT
ATTTGATAAATTAGAGATAGGCATAGCTTCAGATATTACAATTCGTGATA
AATGGTCTTGTGGAGAAATCAAAAAGCCAGAAACTATAAATTACCGTACG
TTTAAACCTGAAAAGGGCGGTCTATTTTGTGAAAAAATCTTTGGTCCTAC
TAAAGATTGGGAATGTTGCTGCGGAAAATATAAAAAAATAAAACATAAAG
GAATTGTCTGCGATCGATGCGGAGTTGAAGTTACTCTTTCAAAAGTCCGT
CGTGAACGTATGGCTCATATCGAGTTAGCAGTTCCTATTGTCCATATTTG
GTTTTTCAAAACAACTCCATCACGCATTGGTAATGTTCTTGGAATGACAG
CTTCGGATCTGGAACGTGTCATTTATTATGAAGAATATGTAGTTATTGAC
CCAGGTAAGACAGACCTAACTAAAAAACAACTTCTTAATGATGCGCAATA
TCGTGAAGTTGTTGAGAAGTGGGGTAAGGACGCTTTCGTTGCTAAAATGG
GTGGCGAAGCTATCTATGATTTGCTTAAATCCGAAGATCTCCAAAGCTTG
CTTAAAGATCTTAAAGAGCGTTTACGCAAAACAAAATCTCAGCAAGCGAG
AATGAAGTTAGCCAAACGTCTTAAAATCATTGAGGGATTTGTTTCTTCAT
CCAACCACCCGGAGTGGATGGTATTAAAAAATATCCCAGTAGTTCCACCT
GATCTCCGTCCTCTTGTTCCTTTAGATGGCGGTCGTTTTGCGACTTCTGA
TTTAAACGATCTCTACCGCCGTGTAATTAATCGTAACAATCGTCTTAAAG
CGATCTTACGTTTAAAAACACCAGAGGTTATTGTTCGTAATGAAAAGCGT
ATGCTTCAAGAAGCTGTTGATGCTCTTTTTGATAACGGTCGACATGGTCA
TCCGGTCATGGGAGCTGGAAACCGACCATTGAAATCCTTGTCAGAAATGT
TAAAGGGAAAAAATGGACGCTTCCGTCAAAATCTTTTAGGAAAACGTGTT
GACTACTCTGGACGTTCTGTAATTATTGTTGGTCCTGAATTGAAGTTTAA
TCAATGCGGATTGCCTAAGGAAATGGCTTTAGAGCTATTCGAACCCTTTA
TTATTAAAAGACTAAAAGATCAAGGCAGCGTTTATACCATTCGTTCTGCT
AAGAAAATGATTCAACGAGGAGCCCCAGAAGTTTGGGACGTTCTCGAAGA
GATCATTAAGGGACATCCAGTACTTCTTAACCGAGCACCTACATTGCACC
GTTTAGGAATTCAAGCTTTCGAACCTGTATTGATAGAAGGTAAAGCGATT
CGTATACACCCCCTAGTTTGCGCAGCGTTTAACGCTGACTTCGACGGAGA
CCAAATGGCCGTGCACGTTCCTCTATCTGTAGAGGCACAACTGGAAGCTA
AAGTTTTAATGATGGCTCCAGACAACATCTTCCTTCCTTCCTCAGGAAAG
CCTGTGGCTATTCCTTCGAAAGATATGACTTTAGGATTATATTATCTGAT
GGCAGATCCTACCTATTTTCCTGAAGAACATGGAGGAAAAACTAAGATAT
TTAAAGATGAAATCGAAGTATTGCGTGCTTTAAATAACGGTGGATTCATT
GATGATGTTTTCGGAGATCGTCGTGATGAAACAGGACGCGGTATCCATAT
TCATGAAAAGATTAAAGTGCGTATTGATGGACAAATTATTGAGACAACCC
CAGGAAGGGTATTGTTCAACAGAATTGTTCCTAAAGAACTCGGCTTCCAA
AATTACAGCATGCCAAGTAAGCGTATAAGTGAGCTTATTTTACAGTGCTA
TAAGAAAGTCGGTTTAGAAGCTACTGTACGTTTCTTAGATGACCTTAAAG
ATCTTGGATTTATTCAAGCTACAAAAGCCGCAATCTCTATGGGATTGAAG
GATGTTCGTATTCCTGATATCAAGAGTCATATCCTCAAAGATGCCTACGA
TAAGGTTGCTATCGTCAAAAAACAATATGATGATGGGATCATTACTGAAG
GGGAGCGTCATTCCAAAACTATTAGTATTTGGACTGAAGTTTCCGAACAG
CTTTCAGATGCCCTCTATGTTGAAATTAGCAAACAAACACGTAGCAAGCA
TAACCCCTTGTTCCTGATGATTGATTCTGGAGCCCGAGGTAATAAATCCC
AGTTGAAACAGTTGGGAGCGTTACGAGGATTAATGGCGAAGCCAAACGGA
GCAATTATTGAATCTCCAATTACTTCGAACTTTAGAGAAGGATTGACAGT
TTTAGAGTACTCCATCTCCTCACACGGTGCGAGAAAAGGTTTAGCCGATA
CAGCTCTAAAAACTGCCGACTCCGGATACTTAACACGTAGACTTGTAGAC
GTAGCCCAAGACGTGATCATTACCGAAAAAGATTGCGGTACGTTAAATCA
CATTGAGATTTCTGCAATAGGTCAAGGTTCTGAAGAACTCTTGCCTCTTA
AAGATCGTATCTATGGACGTACTGTAGCTGAAGATGTCTATCAACCAGGT
GATAAAAGTCGACTACTTGCTCAATCGGGTGATGTACTCAACTCCGTACA
AGCAGAAGCAATTGATGATGCCGGTATTGAGACAATTAAGATTCGTTCTA
CATTAACGTGCGAAAGTCCTCGCGGAGTTTGTGCAAAGTGTTACGGCCTC
AATTTAGCTAATGGTAGACTCATTGGCATGGGTGAAGCTGTTGGTATTAT
TGCTGCTCAGTCGATTGGGGAACCTGGAACTCAGTTAACAATGAGAACGT
TCCACCTAGGGGGTATTGCTGCTACGTCTTCAACTCCTGAGATTATTACG
AATAGTGATGGTATCTTAGTCTACATGGATCTCCGTGTTGTTCTGGGGCA
AGAAGGTCACAATCTTGTCTTGAATAAGAAGGGAGCTTTACATGTTGTAG
GTGATGAAGGTCGTACTCTCAATGAGTATAAAAAGCTGCTTTCAACCAAG
TCTATAGAAAGCCTAGAGGTATTTCCTGTAGAACTAGGAGTGAAAATTCT
TGTTGCTGACGGAACTCCTGTTTCTCAAGGACAAAGAATCGGAGAAGTTG
AACTACACAATATTCCTATCATTTGCGATAAGCCTGGCTTTATTAAATAT
GAAGATTTGGTTGAGGGAATCTCTACAGAGAAAGTTGTGAACAAGAACAC
AGGACTTGTTGAACTTATTGTGAAACAGCACCGAGGGGAGTTACATCCTC
AGATTGCTATCTATGATGATGCTGACTTGTCAGAACTTGTCGGAACCTAT
GCGATTCCTTCAGGAGCGATTATCTCTGTAGAAGAAGGACAACGGGTTGA
TCCAGGTATGTTGTTAGCTAGACTTCCTCGCGGAGCTATCAAAACAAAAG
ATATTACTGGCGGTTTGCCTCGTGTTGCTGAATTAGTAGAAGCTCGTAAA
CCTGAAGATGCTGCTGACATCGCCAAAATTGATGGTGTTGTTGACTTCAA
AGGAATTCAAAAGAACAAACGTATTCTTGTTGTCTGTGATGAAATGACAG
GTATGGAAGAAGAACATCTGATTCCATTAACCAAACATTTGATTGTACAA
CGTGGAGATAGTGTGATTAAAGGGCAGCAGCTTACCGATGGTTTAGTTGT
TCCTCATGAAATCCTAGAAATTTGCGGAGTTCGTGAACTTCAGAAGTACC
TGGTAAATGAGGTGCAGGAAGTTTACCGTCTGCAGGGCGTTGACATTAAC
GATAAGCATATTGAAATTATTGTTCGTCAGATGTTACAAAAAGTACGAAT
TACTGACCCAGGTGATACGACTCTGCTCTTTGGCGAAGACGTGAATAAGA
AAGAGTTTTATGAAGAAAATCGTCGTACCGAAGAAGACGGTGGTAAGCCA
GCTCAAGCTGTTCCCGTCTTATTGGGAATTACGAAAGCTTCTTTGGGTAC
GGAATCGTTTATATCAGCAGCTTCTTTCCAAGACACAACTCGAGTCTTAA
CAGATGCAGCTTGTTGTAGCAAAACCGACTACCTTCTTGGATTTAAGGAA
AATGTGATCATGGGTCATATGATTCCTGGTGGTACAGGCTTTGAAACGCA
TAAGCGTATTAAGCAGTATCTAGAAAAAGAACAAGAAGATCTCGTTTTTG
ATTTTGTTAGTGAAACAGAGTGTGTTTGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy