Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR63 IGR66 IGR69 IGR65 IGR67 IGR64 IGR68 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 rpoB, - CPn0081 rpoC, - CPn0082 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 rpoB, - CPn0081 rpoC, - CPn0082 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 rpoB, - CPn0081 rpoC, - CPn0082 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0081

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoB  

Definition:
DNA-directed RNA polymerase beta subunit

Gene Start:
94261

Gene Stop:
98019

Gene Length:
3759

Molecular Weight*:
140112

pI*:
5.60

Net Charge*:
-21.03

EC:
2.7.7.6  

Functional Class:
transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0081 is orthologously related to CT315: residues 1-1252 of CPn0081 are 90% similar to residues 1-1252 of CT315, a predicted DNA-dependent RNA polymerase, beta subunit.
CPn0081 is also similar to TP024, MG341, UU187.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralog in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 21 to 454 (E-value = 5.1e-30) place CPn0081 in the RNA_pol_Rpb2_1 family which is described as RNA polymerase beta subunit (PF04563)
Residues 455 to 527 (E-value = 3.2e-44) place CPn0081 in the RNA_pol_Rpb2_3 family which is described as RNA polymerase Rpb2, domain 3 (PF04565)
Residues 660 to 1172 (E-value = 4.3e-168) place CPn0081 in the RNA_pol_Rpb2_6 family which is described as RNA polymerase Rpb2, domain 6 (PF00562)
Residues 1174 to 1250 (E-value = 7.8e-46) place CPn0081 in the RNA_pol_Rpb2_7 family which is described as RNA polymerase Rpb2, domain 7 (PF04560)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
891  
922
coil-coil  
969  
1003

PDB Hit:


Gene Protein Sequence:
MLKCPERVSVKKKEDIPDLPNLIEIQIKSYKQFLQIGKLAEERENIGLEE
VFREIFPIKSYNEATVLEYLSYNLGVPKYSPEECIRRGITYSVTLKVRFR
LTDETGIKEEEVYMGTIPLMTDKGTFIINGAERVVVSQVHRSPGINFEQE
KHSKGNILFSFRIIPYRGSWLEAIFDINDLIYIHIDRKKRRRKILAITFI
RALGYSSDADIIEEFFTIGESSLRSEKDFALLVGRILADNIIDEASSLVY
GKAGEKLSTAMLKRMLDAGIASVKIAVDADENHPIIKMLAKDPTDSYEAA
LKDFYRRLRPGEPATLANARSTIMRLFFDPKRYNLGRVGRYKLNRKLGFS
IDDEALSQVTLRKEDVIGALKYLIRLKMGDEKACVDDIDHLANRRVRSVG
ELIQNQCRSGLARMEKIVRERMNLFDFSSDTLTPGKVVSAKGLASVLKDF
FGRSQLSQFMDQTNPVAELTHKRRLSALGPGGLNRERAGFEVRDVHASHY
GRICPIETPEGPNIGLITSLSSFAKINEFGFIETPYRIVRDGIVTDEIEY
MTADVEEECVIAQASASLDEYNMFTEPVCWVRYAGEAFEADTSTVTHMDV
SPKQLVSIVTGLIPFLEHDDANRALMGSNMQRQAVPLLKTEAPVVGTGLE
CRAAKDSGAIVVAEEDGVVDFVDGYKVVVAAKHNPTIKRTYHLKKFLRSN
SGTCINQQPLCAVGDVITKGDVIADGPATDRGELALGKNVLVAFMPWYGY
NFEDAIIISEKLIREDAYTSIYIEEFELTARDTKLGKEEITRDIPNVSDE
VLANLGEDGIIRIGAEVKPGDILVGKITPKSETELAPEERLLRAIFGEKA
ADVKDASLTVPPGTEGVVMDVKVFSRKDRLSKSDDELVEEAVHLKDLQKG
YKNQVATLKTEYREKLGALLLNEKAPAAIIHRRTAEIVVHEGLLFDQETI
ERIEQEDLVDLLMPNCEMYEVLKGLLSDYETALQRLEINYKTEVEHIREG
DADLDHGVIRQVKVYVASKRKLQVGDKMAGRHGNKGVVSKIVPEADMPYL
SNGETVQMILNPLGVPSRMNLGQVLETHLGYAAKTAGIYVKTPVFEGFPE
QRIWDMMIEQGLPEDGKSFLYDGKTGERFDNKVVIGYIYMLKLSHLIADK
IHARSIGPYSLVTQQPLGGKAQMGGQRFGEMEVWALEAYGVAHMLQEILT
VKSDDVSGRTRIYESIVKGENLLRSGTPESFNVLIKEMQGLGLDVRPMVV
DA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAAGTGCCCTGAACGGGTCAGTGTTAAAAAAAAGGAAGATATCCC
AGACCTTCCAAATCTTATCGAAATCCAAATTAAGTCTTATAAGCAGTTTC
TTCAAATTGGAAAATTAGCAGAAGAAAGAGAAAATATCGGTTTAGAAGAG
GTTTTCAGGGAAATTTTTCCCATTAAATCCTATAACGAAGCTACCGTTCT
TGAGTACCTTTCATATAATTTGGGTGTGCCAAAATATTCTCCAGAAGAAT
GTATCCGTAGAGGAATTACCTATAGCGTCACTTTGAAAGTCCGTTTTCGT
TTAACCGATGAAACGGGAATCAAAGAAGAAGAAGTCTATATGGGAACGAT
CCCTCTAATGACTGATAAAGGGACATTTATCATTAATGGAGCTGAAAGAG
TCGTTGTTTCCCAAGTTCATCGTTCTCCAGGAATTAACTTTGAACAAGAA
AAACATTCCAAAGGTAATATTTTATTCTCCTTCAGAATCATTCCTTATCG
TGGAAGTTGGCTCGAAGCTATTTTCGATATTAATGACTTAATTTATATCC
ATATTGATAGAAAAAAACGTAGAAGAAAAATTCTAGCAATCACCTTTATC
CGAGCTCTTGGATACTCTTCAGATGCAGATATCATCGAAGAATTCTTCAC
AATAGGAGAAAGTTCTCTTAGAAGTGAGAAAGACTTTGCTCTTCTTGTTG
GAAGGATTTTAGCAGACAATATTATTGATGAAGCCTCCTCTCTAGTTTAT
GGAAAAGCCGGAGAAAAGTTAAGTACAGCAATGTTAAAACGGATGCTCGA
TGCTGGAATCGCTTCTGTTAAGATTGCTGTAGATGCTGATGAAAATCATC
CTATTATCAAAATGCTCGCTAAGGATCCTACAGATTCATACGAAGCCGCT
TTAAAAGATTTTTATCGTAGACTACGTCCAGGAGAACCTGCAACTCTAGC
TAATGCACGTTCTACTATCATGAGGCTCTTCTTTGACCCCAAACGTTATA
ATCTAGGACGTGTAGGGCGTTATAAGCTCAATCGCAAACTAGGCTTCTCT
ATAGATGATGAAGCTCTGTCTCAAGTTACTTTGAGAAAAGAAGATGTGAT
CGGAGCCTTAAAGTATCTGATTCGTTTGAAAATGGGAGATGAAAAAGCTT
GTGTAGACGATATTGATCATCTTGCTAATCGACGTGTCCGCTCTGTCGGA
GAACTCATTCAAAATCAATGTCGTTCAGGACTTGCTAGAATGGAGAAAAT
TGTTAGAGAGAGAATGAATTTATTCGATTTCTCCTCAGATACGTTGACTC
CAGGAAAAGTTGTCTCTGCTAAAGGTCTCGCTAGCGTGTTAAAAGATTTC
TTTGGCCGCTCCCAGCTTTCGCAGTTTATGGACCAAACCAACCCTGTAGC
TGAGTTAACTCACAAACGACGTCTTTCTGCATTAGGTCCAGGAGGACTAA
ATAGAGAACGCGCAGGATTTGAAGTTCGTGACGTGCACGCAAGTCATTAT
GGACGTATTTGTCCTATTGAAACTCCTGAAGGTCCAAATATTGGTCTGAT
CACCTCTCTTTCCTCTTTTGCTAAAATTAACGAATTTGGATTCATTGAAA
CTCCTTATAGAATTGTAAGAGATGGAATCGTAACAGATGAAATCGAATAC
ATGACAGCCGATGTTGAAGAAGAATGTGTGATTGCACAGGCTTCAGCAAG
CCTAGATGAGTACAATATGTTTACGGAACCCGTCTGTTGGGTACGTTATG
CTGGAGAAGCTTTCGAAGCAGATACAAGCACCGTAACCCATATGGATGTT
TCTCCGAAACAGCTCGTTTCTATTGTTACAGGATTGATTCCTTTCTTAGA
GCACGACGATGCGAACCGCGCCTTGATGGGCTCCAATATGCAACGTCAAG
CGGTTCCCTTACTTAAAACCGAAGCTCCTGTTGTTGGCACTGGATTAGAA
TGTCGTGCTGCTAAAGATTCTGGAGCTATTGTTGTTGCAGAAGAAGATGG
TGTTGTTGATTTTGTTGATGGTTACAAAGTAGTTGTTGCTGCAAAACATA
ATCCTACAATTAAACGTACCTATCATCTGAAAAAGTTCCTTAGATCTAAT
TCAGGAACTTGCATTAACCAACAGCCCTTGTGTGCAGTCGGTGATGTCAT
AACTAAGGGTGATGTGATTGCTGATGGACCCGCAACTGATCGTGGAGAAC
TTGCTTTAGGTAAAAATGTACTCGTTGCCTTTATGCCTTGGTATGGATAC
AACTTTGAGGATGCGATCATTATCTCTGAAAAATTGATCAGAGAAGATGC
CTATACCTCTATTTATATTGAGGAATTCGAACTAACAGCCCGAGATACAA
AATTAGGAAAAGAAGAGATCACTCGTGACATTCCTAACGTATCTGATGAA
GTATTGGCCAATCTCGGTGAGGATGGGATCATTCGTATCGGTGCTGAGGT
TAAACCTGGGGATATTCTTGTTGGTAAGATCACACCAAAATCAGAAACAG
AATTAGCTCCAGAAGAGCGTCTGCTCCGTGCTATTTTTGGTGAAAAAGCT
GCTGACGTTAAAGATGCATCTTTAACAGTGCCTCCAGGAACTGAAGGCGT
CGTTATGGATGTTAAAGTCTTCAGTAGAAAGGATAGATTGTCAAAGAGTG
ATGACGAACTTGTAGAAGAAGCTGTTCATCTTAAAGATTTGCAAAAAGGA
TATAAAAACCAAGTTGCAACTTTAAAAACAGAATATCGTGAGAAATTAGG
AGCTCTCTTATTAAATGAGAAAGCACCTGCAGCCATTATTCACCGTCGTA
CAGCAGAAATCGTTGTTCATGAAGGCCTACTCTTTGATCAAGAGACAATA
GAACGGATAGAACAAGAAGATTTAGTGGATCTTTTAATGCCTAACTGTGA
AATGTATGAAGTGTTGAAAGGACTTCTATCAGATTACGAAACGGCATTAC
AACGGCTAGAAATCAATTATAAGACTGAAGTTGAGCATATTCGTGAGGGA
GATGCAGATTTAGATCATGGTGTCATTCGCCAAGTTAAAGTCTACGTTGC
CTCTAAGAGAAAACTTCAAGTTGGAGATAAAATGGCTGGACGACACGGAA
ATAAAGGTGTTGTTTCCAAAATCGTTCCCGAAGCGGATATGCCATATCTC
TCTAACGGAGAAACTGTACAAATGATCCTGAACCCCCTCGGGGTGCCTTC
AAGGATGAACCTTGGACAGGTATTAGAAACACACCTAGGTTATGCAGCAA
AAACTGCAGGCATTTACGTGAAAACCCCTGTTTTTGAAGGATTCCCTGAA
CAACGTATCTGGGATATGATGATAGAACAGGGATTACCAGAAGATGGGAA
GTCCTTCTTATATGATGGGAAGACAGGTGAACGCTTTGATAACAAGGTAG
TGATAGGCTATATCTATATGCTAAAGCTCAGTCACTTGATCGCTGATAAG
ATTCACGCAAGATCTATAGGGCCATATTCTTTAGTCACGCAACAACCTCT
CGGTGGTAAAGCTCAGATGGGAGGACAAAGATTCGGGGAAATGGAAGTTT
GGGCTCTAGAAGCATATGGGGTTGCTCATATGCTCCAAGAAATTCTAACC
GTGAAATCTGATGATGTCTCAGGAAGAACAAGGATTTACGAATCTATCGT
TAAGGGGGAAAACCTCTTGCGATCAGGAACGCCTGAGTCGTTCAATGTGC
TAATTAAAGAGATGCAGGGTCTAGGACTTGATGTTCGTCCTATGGTCGTA
GACGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy