Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 IGR63 IGR66 IGR69 IGR65 IGR67 IGR64 IGR68 IGR62 IGR61 IGR60 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 rpoC, - CPn0082 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 rpoC, - CPn0082 CPn0072 infA, - CPn0073 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 rpoC, - CPn0082 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0079

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl10  

Definition:
50S ribosomal protein L10

Gene Start:
93179

Gene Stop:
93691

Gene Length:
513

Molecular Weight*:
18414

pI*:
7.30

Net Charge*:
0.34

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The ribosomal protein L10 forms an aggregate
with the L7/L12 protein (see CT316), a complex
sometimes referred to as L8. In addition to its translational
role, L10 in E. coli negatively affects translation of
certain operons.

Blast Summary:  PSI-Blast Search
CPn0079 is orthologously related to CT317: residues 1-169 are 82% similar to that of CT317. BLAST reveals no significant similarity to
T. pallidum or U. urealyticum. Slight similarity to MP0304 (predicted ribosomal protein L10, RpsJ), UU010 (ribosomal protein L10, rpL10).


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 98 (E-value = 4.7e-05) place CPn0079 in the Ribosomal_L10 family which is described as Ribosomal protein L10 (PF00466)

PDB Hit:


Gene Protein Sequence:
MKQEKTLLLQEVEDKISAAQGFILLRYLRFTAAYSREFRNSLSGVSAEFE
VLKKRIFFKAIEAAGLEVDCSDTDGHLGVVFSCGDPVSAAKQVLDFNKQH
KDSLVFLAGRMDNASLSGAEVEAVAKLPSLKELRQQVVGLFAAPMSQVVG
IMNSVLSGVISCVDQKAGKN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAAGAAAAAACATTACTTCTTCAAGAGGTAGAAGACAAAATTTC
CGCAGCACAGGGATTCATTTTATTAAGATACCTTAGATTTACCGCCGCGT
ATTCTAGAGAATTCAGAAACTCACTTTCTGGAGTTTCTGCAGAATTTGAA
GTTTTAAAGAAGAGAATCTTCTTTAAAGCTATAGAAGCTGCAGGTTTAGA
GGTAGATTGTAGTGATACAGATGGGCATCTCGGTGTAGTCTTTTCCTGTG
GAGATCCTGTTTCTGCCGCAAAGCAGGTACTGGACTTTAATAAACAACAT
AAAGACTCTTTAGTTTTCCTCGCTGGAAGGATGGACAATGCGTCTCTGTC
TGGTGCAGAGGTAGAAGCTGTCGCCAAATTGCCATCTCTTAAAGAACTTA
GACAGCAGGTTGTTGGTTTATTCGCTGCTCCAATGTCCCAAGTTGTAGGA
ATTATGAATTCTGTCCTTTCTGGAGTGATCTCCTGTGTGGATCAAAAGGC
AGGAAAGAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy