Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 IGR63 IGR59 IGR66 IGR65 IGR67 IGR64 IGR68 IGR62 IGR61 IGR60 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 CPn0072 CPn0071 infA, - CPn0073 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0078

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl1  

Definition:
50S ribosomal protein L1

Gene Start:
92465

Gene Stop:
93163

Gene Length:
699

Molecular Weight*:
25062

pI*:
10.30

Net Charge*:
10.15

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The L1 component of the 50S ribosomal RNA is
thought to bind to
the 23S particle and also to serve as a
translational
repressor of the L11 operon. A 3D structure is
available for
the RL1_THETH.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 50S ribosomal
protein L1 sequences, e.g. residues 1-225 are 57% similar to that of RL1_BACST. Residues 1-230
are 50% similar to that of RL1_THEMA.

CPn0078 is 43% similar to TP0238 in T. pallidum,40% similar to UU540 in U. urealyticum, and 39%
to MG082 in M. genitalium. All are predicated 50S ribosomal proteins L1.

CPn0078 is orthologously related to CT318:
residues 1-231 are 82% similar to that of CT318.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae

Pfam Summary:  Pfam Search
Residues 15 to 221 (E-value = 1.5e-108) place CPn0078 in the Ribosomal_L1 family which is described as Ribosomal protein L1p/L10e family (PF00687)

PDB Hit:


Gene Protein Sequence:
MTKHGKRIRGILKNYDFSKSYSLREAIDILKQCPPVRFDQTVDVSIKLGI
DPKKSDQQIRGAVFLPNGTGKTLRILVFASGNKVKEAVEAGADFMGSDDL
VEKIKSGWLEFDVAVATPDMMREVGKLGKVLGPRNLMPTPKTGTVTTDVA
KAISELRKGKIEFKADRAGVCNVGVGKLSFESSQIKENIEALSSALIKAK
PPAAKGQYLVSFTISSTMGPGISIDTRELMAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAAACATGGAAAACGTATACGAGGCATCTTAAAGAACTATGATTT
CTCAAAATCATATTCTTTGCGGGAGGCTATAGATATTTTAAAACAATGTC
CTCCAGTACGCTTCGATCAAACTGTAGATGTATCTATCAAGTTAGGGATA
GATCCTAAAAAGAGCGACCAACAAATTCGTGGAGCCGTTTTTTTACCTAA
TGGTACAGGAAAAACTTTAAGAATTTTGGTTTTTGCTTCAGGGAACAAAG
TCAAAGAAGCTGTTGAAGCGGGCGCAGACTTTATGGGAAGCGACGATCTT
GTTGAAAAAATTAAATCCGGGTGGCTGGAATTCGATGTTGCTGTCGCTAC
CCCAGATATGATGCGTGAAGTAGGAAAATTAGGAAAAGTCTTAGGACCTA
GAAATCTAATGCCTACACCTAAAACAGGAACGGTAACCACAGACGTTGCT
AAAGCAATCTCCGAATTGCGTAAAGGAAAAATTGAATTTAAAGCAGACCG
CGCAGGCGTATGTAATGTAGGCGTAGGTAAGTTGTCTTTTGAAAGCAGTC
AAATCAAAGAAAATATTGAAGCTCTAAGTTCTGCTTTAATTAAGGCCAAA
CCTCCTGCAGCTAAAGGTCAATATTTAGTCTCATTCACTATTTCTTCCAC
TATGGGGCCTGGTATTTCTATAGATACTAGAGAATTAATGGCATCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy