Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR63 IGR59 IGR66 IGR65 IGR67 IGR64 IGR68 IGR62 IGR61 IGR58 IGR60 CPn0070 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 CPn0070 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 CPn0071 CPn0072 CPn0070 infA, - CPn0073 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 rpoB, - CPn0081 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0077

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl11  

Definition:
50S ribosomal protein L11

Gene Start:
92013

Gene Stop:
92438

Gene Length:
426

Molecular Weight*:
15073

pI*:
10.40

Net Charge*:
6.94

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 50S ribosomal
protein L1, e.g., 63% similarity to RL11_BACSU
and 62% similarity to RL11_STACA. CPn0077 is similar to
TP0237 in T. pellidum, to MG081 in M. genitalium, and to UU541 in U.
urealyticum, all predicted 50S ribosomal protein L11.

CPn0077 is orthologously related to CT319:
residues 1-141 are 87% similar to CT319.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 9 to 67 (E-value = 3e-31) place CPn0077 in the Ribosomal_L11_N family which is described as Ribosomal protein L11, N-terminal domain (PF03946)
Residues 72 to 140 (E-value = 5e-30) place CPn0077 in the Ribosomal_L11 family which is described as Ribosomal protein L11, RNA binding domain (PF00298)

PDB Hit:


Gene Protein Sequence:
MSVKKVIKIIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDK
PGDLLPVVITVYADKTFTFITKQPPVSSLIKKTLNLESGSKIPNRNKVGK
LTQAQVEAIAEQKMKDMDIVLLESAKRMVEGTARSMGIDVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGGTAAAAAAGGTAATCAAAATAATTAAGTTGCAAATCCCTGGGGG
TAAAGCAAATCCTGCGCCACCCATAGGACCAGCTTTAGGTGCTGCTGGAG
TCAATATTATGGGCTTCTGTAAGGAGTTTAATGCTGCAACTCAAGATAAG
CCTGGAGACTTACTTCCAGTAGTCATCACTGTTTATGCTGATAAAACTTT
TACTTTTATAACCAAACAGCCTCCAGTCTCCTCTTTAATAAAGAAAACTT
TGAATCTGGAATCAGGATCTAAAATTCCTAATCGTAATAAAGTAGGAAAA
CTTACTCAGGCTCAAGTTGAAGCAATTGCTGAACAAAAAATGAAAGATAT
GGATATTGTCCTTCTAGAATCTGCGAAACGTATGGTGGAAGGAACTGCCC
GTAGTATGGGTATAGACGTAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy