Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR63 IGR59 IGR66 IGR65 IGR67 IGR64 IGR57 IGR68 IGR62 IGR61 IGR58 IGR60 CPn0070 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0070 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0071 CPn0072 CPn0070 infA, - CPn0073 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0076

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nusG  

Definition:
transcription antiterminator

Gene Start:
91358

Gene Stop:
91906

Gene Length:
549

Molecular Weight*:
20807

pI*:
4.90

Net Charge*:
-8.02

EC:
 

Functional Class:
transcription; transcription factors  

Pathway: pathway table

Comment:
The NusG protein is part of the transcription complex,
interacting with RNA polymerase and the termination factor
rho.

Transcriptional antitermination protein influences transcription
termination and antitermination. Acts as a component of the
transcription complex, and interacts with the termination factor
rho and RNA polymerase.

Blast Summary:  PSI-Blast Search
CPn0076 is orthologously related to CT320: residues 1-182 of CPn0076 are 87% similar to residues 1-182 of CT320, transcription terminator NusG from C. trachomatis.
CPn0076 is also similar to TP0236.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in c. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 44 (E-value = 1.6e-21) place CPn0076 in the NusG family which is described as Transcription termination factor nusG (PF02357)
Residues 121 to 158 (E-value = 5.4e-08) place CPn0076 in the KOW family which is described as KOW motif (PF00467)

PDB Hit:


Gene Protein Sequence:
MYKWYVVQVFTAQEKKVKKALEDFKESSGMTDFIQEIILPIENVMEVKKG
EHKVVEKYIWPGYLLVKMHLTDESWLYVKSTAGIVEFLGGGVPVALSEDE
VRSILTDIEEKKSGVVQKHQFEVGSRVKINDGVFVNFIGMVSEVFHDKGR
LSVMVSIFGRETRVDDLEFWQVEEVAPGQESE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATAAATGGTATGTCGTTCAAGTTTTTACAGCTCAAGAAAAGAAAGT
AAAAAAGGCTTTAGAAGATTTTAAAGAGTCTTCAGGAATGACTGATTTTA
TACAGGAAATTATCTTGCCTATTGAAAATGTCATGGAAGTGAAAAAAGGA
GAACATAAGGTCGTTGAAAAATACATCTGGCCTGGATACCTCTTAGTTAA
AATGCATCTGACTGACGAGTCTTGGCTCTATGTTAAAAGTACAGCAGGTA
TAGTCGAGTTTCTTGGAGGCGGAGTCCCTGTAGCTCTTTCTGAAGATGAA
GTAAGAAGTATCTTAACAGATATAGAAGAGAAGAAATCGGGAGTGGTGCA
AAAACATCAGTTCGAGGTTGGTTCTAGAGTGAAAATTAATGACGGAGTCT
TTGTCAATTTTATCGGCATGGTTTCCGAAGTTTTCCATGATAAAGGACGC
CTGAGTGTTATGGTTTCTATCTTTGGAAGAGAAACTAGGGTAGATGATTT
AGAATTTTGGCAAGTGGAAGAGGTAGCCCCAGGGCAAGAAAGTGAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy