Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR63 IGR59 IGR66 IGR65 IGR67 IGR64 IGR57 IGR68 IGR62 IGR61 IGR58 IGR60 CPn0070 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0070 CPn0071 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0071 CPn0072 CPn0070 infA, - CPn0073 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0075

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic) (possible preprotein translocase secE sequence)

Gene Start:
91102

Gene Stop:
91353

Gene Length:
252

Molecular Weight*:
9536

pI*:
10.90

Net Charge*:
10.41

EC:
 

Functional Class:
cellular processes; standard protein secretion  

Pathway: pathway table

Comment:
See CT321.

Blast Summary:  PSI-Blast Search
Only significant hit in gapped BLAST to CT321: residues 1-83 are 61% similar to CT321.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
Residues 23-64 represent blocks BL01067 (Protein secE/sec61-gamma proteins) with an E-value of 1.2e-05.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
49  
66

PDB Hit:


Gene Protein Sequence:
MKQQHNRKALSRKIGTVKKQAKFAGSFLDEIKKIEWVSKHDLKKYIKVVL
ISIFGFGFAIYFVDLVLRKSITCLDGITTFLFG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAACAACACAATCGTAAGGCTTTATCTCGCAAGATTGGCACAGT
GAAAAAACAAGCCAAATTTGCAGGAAGCTTTTTAGATGAGATTAAAAAAA
TTGAATGGGTAAGCAAGCACGATCTTAAGAAATACATAAAAGTAGTTCTT
ATCAGTATTTTTGGTTTTGGATTTGCTATTTATTTCGTAGATCTTGTGTT
GCGTAAGTCAATCACATGTTTAGATGGTATAACAACCTTTTTGTTCGGTT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy