Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR63 IGR59 IGR66 IGR65 IGR67 IGR64 IGR57 IGR68 IGR62 IGR61 IGR58 IGR60 IGR56 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl7, - CPn0080 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0071 CPn0068 CPn0072 CPn0070 infA, - CPn0073 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 tufA, - CPn0074 CPn0069 rpoB, - CPn0081 CPn0075 rl7, - CPn0080
* Calculated from Protein Sequence

Gene ID: CPn0073

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
infA  

Definition:
translation initiation factor IF-1

Gene Start:
89356

Gene Stop:
89577

Gene Length:
222

Molecular Weight*:
8338

pI*:
10.10

Net Charge*:
3.66

EC:
 

Functional Class:
translation; translation factors  

Pathway: pathway table

Comment:
Translation initiation factor IF-1 has, so far, not been assigned a specific function; however, it seems to stimulate more or less all the activities of the other two initiation factors, IF-2 and IF-3.
Appears to be cytoplasmic.


Blast Summary:  PSI-Blast Search
CPn0073 is orthologously related to CT323: residues 1-73 of CPn0073 are 91% similar to residues 1-73 of CT323, a predicted translation initiation factor IF-1 from C. trachomatis.
CPn0073 is also similar to UU253, a predicted initiation factor IF-1 from U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MAKKEDTLVLEGKVEELLPGMHFRVILENGMPVTAHLCGKMRMSNIRLLV
GDRVTVEMSAYDLTKARVVYRHR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGAAAAAAGAAGATACTCTTGTACTCGAAGGTAAGGTAGAAGAGCT
CCTTCCAGGAATGCATTTTCGTGTAATACTAGAAAACGGTATGCCAGTTA
CCGCCCATTTGTGCGGAAAAATGCGTATGAGTAATATTCGATTGCTTGTT
GGAGACCGCGTTACTGTCGAGATGTCCGCCTATGACTTAACAAAAGCTAG
GGTTGTCTACAGACATCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy