Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR63 IGR59 IGR66 IGR65 IGR64 IGR57 IGR62 IGR61 IGR58 IGR55 IGR60 IGR56 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 CPn0067 tufA, - CPn0074 CPn0069 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 CPn0067 tufA, - CPn0074 CPn0069 CPn0071 CPn0068 CPn0072 CPn0070 infA, - CPn0073 rl11, - CPn0077 rl10, - CPn0079 nusG, - CPn0076 rl1, - CPn0078 CPn0067 tufA, - CPn0074 CPn0069 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0072

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
89061

Gene Stop:
88054

Gene Length:
1008

Molecular Weight*:
37052

pI*:
7.80

Net Charge*:
2.88

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0072 is orthologously related to CT324: residues 26-332 of CPn0072 are 45% similar to residues 18-302 of CT324, a predicted hypothetical (basic) from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
74
transmembrane  
90  
114
transmembrane  
119  
136
transmembrane  
171  
191
coil-coil  
218  
245

PDB Hit:


Gene Protein Sequence:
MSTPLSSGGISPSDQYVPQELFCDRLSSSRSNSPDSNASGDSPIVSPPIS
ALVALTDLKLVPYNQNSFSWTTRLKNAVEKIGLFLQRNWKYILLYILAWA
LILVCHHTVALTLTIWLGVGLGIGVVFGIFTATCLDKENKHRHVNSLWNL
INHGILQLDPNGTRQILLATMIASISALIYAVPQAVGLVIGFSIGNQLSI
NTVYGARLGDEATYAIDRKAHKKRIENIEQAINQHQIIKHQMINQKQLNA
LIEINRNNQTDPATANLLASLKLNLNQPMPYCFSMPECGVTSSYLDLNNN
SPDDIIARADQCIMTLSQTLQQIKKEPDRIIESNH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTACTCCACTATCTTCTGGAGGAATTTCGCCTTCTGACCAATACGT
TCCTCAAGAACTATTTTGTGACAGACTGAGCTCTTCTAGATCGAACTCTC
CTGATTCAAATGCTTCAGGGGACTCTCCTATAGTCAGCCCTCCTATTTCA
GCGTTAGTTGCATTAACTGATCTGAAATTAGTTCCTTATAATCAAAATTC
ATTTTCTTGGACAACTCGTTTAAAAAACGCGGTTGAAAAAATTGGTTTAT
TCCTCCAAAGGAATTGGAAATATATATTACTTTATATTTTAGCTTGGGCA
TTAATTTTAGTATGTCATCATACGGTTGCTTTAACTCTAACAATTTGGTT
AGGGGTGGGTCTAGGGATTGGCGTTGTTTTTGGCATTTTTACAGCGACAT
GTTTAGATAAAGAGAACAAGCATAGGCATGTAAACAGTCTATGGAATTTG
ATAAACCATGGAATTTTGCAATTAGATCCGAACGGAACACGACAAATTCT
TTTAGCCACGATGATAGCCTCTATTTCAGCGTTGATTTATGCGGTTCCTC
AGGCTGTTGGTCTTGTTATAGGTTTTTCCATTGGAAATCAATTAAGTATT
AATACTGTTTATGGGGCGCGCTTAGGAGATGAGGCTACTTATGCTATTGA
TCGCAAGGCCCACAAAAAACGAATAGAGAACATTGAGCAAGCGATCAACC
AGCATCAAATCATCAAGCACCAAATGATCAATCAAAAGCAGTTGAATGCG
CTTATAGAGATAAATCGCAACAACCAAACGGATCCTGCCACAGCGAATCT
TTTAGCTTCTTTGAAACTAAACTTAAATCAGCCTATGCCCTATTGTTTTT
CGATGCCAGAATGTGGTGTAACTAGCTCATACCTTGACTTGAATAACAAC
AGTCCTGATGATATTATTGCAAGAGCTGACCAATGTATTATGACCTTATC
TCAGACTTTGCAACAAATCAAAAAAGAGCCTGATCGTATCATTGAATCAA
ATCATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy