Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR63 IGR59 IGR65 IGR64 IGR57 IGR62 IGR61 IGR58 IGR55 IGR60 IGR54 IGR56 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl11, - CPn0077 nusG, - CPn0076 rl1, - CPn0078 CPn0067 tufA, - CPn0074 CPn0069 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl11, - CPn0077 nusG, - CPn0076 rl1, - CPn0078 CPn0067 tufA, - CPn0074 CPn0069 CPn0071 CPn0068 CPn0072 CPn0070 infA, - CPn0073 rl11, - CPn0077 nusG, - CPn0076 rl1, - CPn0078 CPn0067 tufA, - CPn0074 CPn0069 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0071

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
88045

Gene Stop:
87596

Gene Length:
450

Molecular Weight*:
17369

pI*:
8.50

Net Charge*:
3.52

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0071 is orthologously related to CT325: residues 6-144 of CPn0071 are 55% similar to residues 6-144 of CT325, a predicted conserved hypothetical protein from C. trachomatis.
No similarity to UU, MG, TP.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 20 to 141 (E-value = 1.2e-66) place CPn0071 in the SufE family which is described as Fe-S metabolism associated domain (PF02657)

PDB Hit:


Gene Protein Sequence:
LEFICPLQHARCLKKQHKIIEELFPEPFQKDHLYLKLMENSSSRDAFDKK
RMLKENLVVGCQSDLYLYEVYQDGILFFFTYTKALMSSGIASLFTEVYSG
ETPSTILTCKPIFFQRLTPYLSFGRLNGGESLYMRMKQIAVQYLKPPQT$


Gene Nucleotide Sequence:  Sequence Viewer
TTGGAATTTATCTGTCCTCTGCAACACGCTAGGTGTTTAAAAAAACAGCA
TAAAATTATTGAGGAGCTATTTCCAGAACCTTTTCAAAAAGATCATCTGT
ATCTTAAGTTGATGGAAAATAGTTCTTCAAGGGATGCTTTTGACAAGAAG
CGCATGTTGAAGGAGAACTTGGTTGTAGGTTGTCAGAGTGATTTATATCT
TTACGAGGTATATCAAGATGGAATTTTATTTTTTTTCACTTATACGAAAG
CTTTAATGTCTTCAGGAATCGCCTCTTTATTTACTGAGGTATATTCTGGA
GAAACTCCTTCTACAATTTTGACATGCAAGCCAATTTTTTTTCAGCGCCT
GACTCCCTATCTTTCTTTTGGTAGGTTGAATGGTGGAGAATCTCTGTACA
TGCGTATGAAGCAAATAGCGGTACAATACTTAAAGCCGCCTCAAACATAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy