Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR63 IGR59 IGR64 IGR57 IGR62 IGR61 IGR58 IGR55 IGR60 IGR54 IGR56 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl11, - CPn0077 nusG, - CPn0076 CPn0067 tufA, - CPn0074 CPn0066 CPn0069 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 rl11, - CPn0077 nusG, - CPn0076 CPn0067 tufA, - CPn0074 CPn0066 CPn0069 CPn0071 CPn0068 CPn0072 CPn0070 infA, - CPn0073 rl11, - CPn0077 nusG, - CPn0076 CPn0067 tufA, - CPn0074 CPn0066 CPn0069 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0070

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
87378

Gene Stop:
87205

Gene Length:
174

Molecular Weight*:
6751

pI*:
10.70

Net Charge*:
3.22

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LKNQNFFSNQSRTYEQRFPKVSPHFESILRLQSVGFSSQGTLLISFRDTE
LKRDLYI$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAAAATCAAAACTTTTTTTCTAATCAGTCACGCACCTACGAACAGAG
ATTCCCAAAGGTGTCCCCTCATTTCGAGTCTATTCTTCGGTTGCAATCTG
TAGGGTTTTCTTCACAAGGAACCCTTTTGATTTCATTTAGAGATACGGAA
CTAAAAAGAGATCTTTATATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy