Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_1 tRNA_Trp_1 tRNA_Met_1 IGR59 IGR57 IGR62 IGR61 IGR58 IGR55 IGR60 IGR54 IGR56 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 CPn0067 tufA, - CPn0074 CPn0066 CPn0069 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0075 CPn0067 tufA, - CPn0074 CPn0066 CPn0069 CPn0071 CPn0068 CPn0072 CPn0070 infA, - CPn0073 CPn0067 tufA, - CPn0074 CPn0066 CPn0069 CPn0075
* Calculated from Protein Sequence

Gene ID: CPn0069

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
85236

Gene Stop:
87089

Gene Length:
1854

Molecular Weight*:
69652

pI*:
6.60

Net Charge*:
-4.35

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
This is a C. pneumoniae-specific protein with no similarities to a known sequence in any other organisms.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0069 is paralogously related to CPn0066 and CPn0381, both hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
106
transmembrane  
399  
416
non-globular  
417  
459
transmembrane  
471  
488
transmembrane  
524  
541
transmembrane  
588  
605

PDB Hit:


Gene Protein Sequence:
MTTPPPSRSSSPPPYDWIELQDLGNTNNNSSRATPPPPEVGGELPPYFSA
SNFVVIERGAPSLPSPQQLLSLPEYSRQPPPGYFDETASITSRTSEEMFG
TLVSTLCCPANSERDWEDHEVNCIYIASTSDTQLEAVQGGMHITELRGEP
VRVLYETGHLYAFARENTCHSRLEVSHTVRAMTYFWDRFFSRHWNVGRRF
LVFYQGNGGAYVQAALDSSMHTQDIYVLGLSPTVYIRGNYHVQHYRVRGF
WPSCLDSLAACAENTSVLPYGESSDGIFYPSLFSHTFDNAIRYGERCLLV
CSEGMGMLPETQQQTSPLTSLEGGHEVALVLNPQQNPEALSIASRLMHEE
RGGRLESNYMPGRSSNPFMTSMYVLVRLNTLAQIYLMSPYYSFQSNDIVC
LIFISSAAVETVSYIFLTVTDSTCGRRYLRVPRLVCTGLRNLALPTTLLE
LLILSYPRSVEGVPFNVRFILGYMCTTRVVFFAWNLILHWPFRCLRHGIQ
LFVHRSIIGHTLGARITDLTLASMRYAIVFPSIVSSCLLTALAHANTNIL
ALDPYRLIESGDLRRPAFNDDEMQQADNPWDAYSIGLVINTCIYMLILFA
NLIFMVYSVRRYHRSRR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACACCCCCACCATCCCGATCCTCCTCTCCTCCTCCCTATGATTG
GATAGAACTTCAAGATCTGGGGAATACGAATAACAATAGCAGTCGAGCTA
CCCCCCCCCCCCCCGAAGTAGGCGGTGAGCTGCCCCCGTATTTTTCAGCT
AGCAACTTTGTTGTAATAGAGCGGGGCGCTCCTAGTCTGCCTTCTCCACA
GCAACTTTTATCTCTTCCAGAATATTCTAGGCAGCCGCCACCAGGATATT
TTGATGAAACAGCAAGCATAACTAGCAGAACGAGTGAAGAGATGTTTGGT
ACCTTGGTCTCTACCTTGTGTTGTCCTGCCAACTCGGAAAGGGATTGGGA
AGATCACGAGGTAAATTGTATTTATATTGCTAGTACCAGTGACACTCAAC
TTGAAGCTGTTCAAGGTGGGATGCATATCACTGAGTTACGTGGTGAACCC
GTAAGAGTTCTTTATGAGACGGGTCACTTATACGCATTTGCTAGAGAAAA
TACATGTCATTCCCGTTTAGAAGTTAGCCATACAGTTAGAGCTATGACGT
ACTTTTGGGACCGATTTTTTAGTCGCCACTGGAACGTGGGGCGACGTTTC
CTAGTATTTTACCAGGGAAACGGAGGCGCCTATGTTCAGGCAGCCCTCGA
TTCATCCATGCATACTCAGGATATCTATGTTCTAGGGCTCTCTCCGACTG
TCTATATTAGAGGGAACTATCACGTACAGCACTACCGTGTTCGAGGATTT
TGGCCCTCTTGCCTGGATTCTCTAGCGGCCTGTGCGGAAAATACATCAGT
ACTTCCCTACGGGGAATCGAGTGACGGAATCTTTTACCCCTCTCTATTCA
GCCACACATTTGATAACGCGATACGGTATGGTGAGAGATGCCTGTTGGTT
TGTTCTGAGGGCATGGGAATGCTTCCAGAAACGCAACAACAAACATCTCC
TTTAACTTCACTAGAAGGGGGACATGAGGTAGCTCTAGTTCTCAATCCCC
AGCAGAACCCAGAGGCTCTAAGTATTGCCTCTAGATTGATGCATGAAGAA
AGAGGTGGGAGATTAGAATCTAACTATATGCCTGGACGTTCTAGTAATCC
TTTCATGACAAGTATGTATGTTCTCGTACGGCTGAATACACTTGCTCAGA
TCTACCTGATGTCTCCTTATTATTCTTTCCAAAGCAACGACATTGTATGC
CTTATCTTTATAAGCAGTGCTGCTGTAGAGACAGTAAGCTACATATTCCT
GACTGTAACTGACTCAACTTGTGGGCGTCGGTACCTGCGTGTCCCACGGC
TAGTTTGTACAGGGTTACGTAACCTGGCGTTACCCACAACTCTACTAGAG
CTACTTATTTTGTCATACCCTCGATCAGTAGAGGGGGTACCTTTCAATGT
TAGATTCATTCTTGGATATATGTGCACTACTAGAGTTGTATTTTTTGCAT
GGAACTTGATCCTCCACTGGCCTTTCCGATGTCTACGCCATGGAATCCAA
TTGTTTGTTCATAGAAGTATAATAGGACATACGTTGGGAGCAAGAATTAC
TGATTTAACCCTAGCAAGTATGCGATACGCAATAGTGTTTCCATCTATAG
TAAGTTCATGCTTGTTAACTGCTCTTGCTCATGCAAATACTAACATACTT
GCCTTGGACCCTTATAGATTGATCGAATCTGGAGATTTAAGACGTCCCGC
ATTTAATGATGATGAAATGCAACAAGCAGATAATCCTTGGGATGCTTACT
CTATCGGCTTAGTTATAAACACGTGTATCTACATGTTAATTTTATTCGCA
AACCTAATTTTCATGGTGTACTCTGTACGAAGATACCATAGATCCCGCCG
CTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy