Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_1 IGR59 IGR57 IGR61 IGR58 IGR53 IGR55 IGR60 IGR54 IGR56 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0067 CPn0065 CPn0066 CPn0069 CPn0070 CPn0071 CPn0068 CPn0072 infA, - CPn0073 CPn0067 CPn0065 CPn0066 CPn0069 CPn0071 CPn0068 CPn0072 CPn0070 infA, - CPn0073 CPn0067 CPn0065 CPn0066 CPn0069
* Calculated from Protein Sequence

Gene ID: CPn0068

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein (acidic)

Gene Start:
84903

Gene Stop:
84328

Gene Length:
576

Molecular Weight*:
22194

pI*:
4.50

Net Charge*:
-14.21

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia pneumoniae-specific hypothetical protein.
No homology to C. trachomatis.

Blast Summary:  PSI-Blast Search
CPn0068 is weakly similar to CT360, a predicted hypothetical protein. Residues 26-183 are 27% similar to CT360 (Score is 53, e value is 1e-8).
No similarity to U. ureaplasma, T. pallidum, M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
17
non-globular  
18  
99
coil-coil  
132  
180

PDB Hit:


Gene Protein Sequence:
MIKKFFIYSLIFSCSFSAPLKGICNEDVSSQSRIEEDPEVLITQLNELIE
TPIEEGKEIRNELQAISDGQKSSEEIEESCGTSDSEGLSEKTDKESSNEY
VLDFFDSMVQRLEGISKMCQSGQVAQIIDCFNREFDIRNRELELKNRELE
LREKDLEFKKSILDWNKEKVSRELAFQREQDIKQTLMLLKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAGAAATTTTTTATTTATAGTTTAATTTTCTCCTGCAGTTTCTC
CGCTCCCCTAAAAGGCATTTGCAATGAGGATGTCTCTTCTCAGTCCAGAA
TTGAGGAGGATCCTGAAGTTTTAATAACACAACTCAATGAGCTGATTGAA
ACCCCAATCGAAGAGGGCAAAGAGATACGTAATGAACTACAAGCAATTTC
CGACGGGCAAAAAAGTTCGGAAGAGATTGAGGAAAGTTGTGGTACTTCTG
ACTCAGAAGGTCTTTCTGAAAAGACTGATAAAGAGTCTTCTAATGAATAT
GTCTTAGATTTTTTCGATAGCATGGTTCAAAGATTAGAGGGCATTTCTAA
GATGTGTCAATCTGGACAAGTTGCCCAAATTATCGATTGTTTTAATCGTG
AATTTGACATTCGGAACCGCGAATTGGAGTTGAAAAATCGCGAATTAGAG
CTCCGAGAGAAGGATTTAGAGTTTAAAAAGTCCATTTTAGATTGGAATAA
AGAAAAAGTAAGCCGCGAGCTAGCATTTCAACGTGAACAAGATATTAAAC
AAACTCTTATGCTATTAAAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy