Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_1 IGR59 IGR57 IGR58 IGR53 IGR55 IGR54 IGR56 IGR52 CPn0070 CPn0071 CPn0068 CPn0072 CPn0064 CPn0067 CPn0065 CPn0066 CPn0069 CPn0070 CPn0071 CPn0068 CPn0072 CPn0064 CPn0067 CPn0065 CPn0066 CPn0069 CPn0070 CPn0068 CPn0072 CPn0071 CPn0064 CPn0067 CPn0065 CPn0066 CPn0069
* Calculated from Protein Sequence

Gene ID: CPn0067

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
82953

Gene Stop:
84056

Gene Length:
1104

Molecular Weight*:
42168

pI*:
6.90

Net Charge*:
-0.84

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae.
BLAST reveals no significant similarity to C.trachomatis, M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Residues 33-268 are 31% similar to CPn0169, a predicted hypothetical protein.
Residues 168-365 are 34% similar to CPn0165, a predicted hypothetical protein.
Residues 7-145 are 30% similar to CPn0164, a predicted hypothetical protein.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
35  
59
transmembrane  
64  
82

PDB Hit:


Gene Protein Sequence:
MAVEGRVNSSQALNQDCQEVLANKQSKGLLRCRILSIVVAVITFIAGVVL
IALTLASILTSVPYLALGVFLLIVTLGCIIFALCSEKIKKVPPTPISHKE
EIIAWFEERKNIDMEKEKEDPEHFGRTATDIPMRSALDQFNHSCHHIHES
PALTETYRSHQDVLLFKDWCPVTLPDVTSEEEVLIRSVVGSYLLMEACVP
KVSMLIDELHNKLKSPSERECLFIDKKTLQRKASFLFTQKDLATFFLAYT
RVNDGHLAPFRAGAKWILIHYVRLRRQHNQNDFFTPGHSCYYARLAFNQT
QRLYHQLFNVEKLRSIYANMDKDPLCHPWAFIPIYDLLKTEDHGDGFLEQ
QEDREYPSRAAQDQFWG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGTAGAAGGAAGAGTAAATAGTTCTCAAGCCTTAAATCAAGATTG
TCAAGAAGTCTTAGCAAATAAACAATCGAAAGGCCTCCTAAGGTGCAGAA
TTCTATCTATAGTAGTAGCTGTTATCACCTTTATCGCCGGGGTTGTGTTG
ATAGCTTTAACATTAGCCTCTATTTTAACTTCTGTTCCCTACTTAGCGTT
AGGAGTGTTTTTACTGATTGTCACTCTGGGATGTATAATATTTGCTCTTT
GCTCTGAGAAAATAAAAAAGGTTCCCCCGACTCCTATTTCACATAAAGAG
GAGATCATTGCCTGGTTCGAAGAAAGAAAAAATATTGATATGGAAAAGGA
AAAAGAAGATCCGGAGCATTTTGGAAGAACCGCTACGGATATCCCAATGA
GATCTGCATTAGATCAGTTTAACCACTCTTGTCACCATATTCACGAGAGC
CCCGCGTTAACAGAAACTTATAGAAGCCATCAAGATGTTCTCCTCTTTAA
GGACTGGTGTCCTGTTACGTTGCCTGATGTAACCTCAGAAGAAGAAGTCT
TAATACGCAGTGTGGTTGGTAGCTATTTATTAATGGAGGCGTGCGTTCCA
AAAGTATCCATGCTTATCGACGAACTCCATAATAAGCTTAAATCTCCTTC
CGAAAGAGAGTGCCTCTTTATAGATAAAAAAACATTGCAGCGAAAAGCTA
GTTTTCTTTTCACTCAGAAAGATCTCGCAACATTCTTTCTTGCTTATACG
CGGGTGAATGATGGTCATTTAGCACCGTTTCGAGCAGGAGCAAAATGGAT
CTTAATACATTACGTTAGGTTAAGACGTCAACACAATCAGAACGACTTTT
TTACTCCAGGACATTCTTGTTACTATGCTCGTCTAGCCTTTAACCAAACC
CAACGACTCTATCATCAATTATTCAATGTAGAAAAGCTTCGTAGTATCTA
TGCGAACATGGATAAAGACCCTCTATGTCACCCATGGGCTTTCATTCCTA
TCTATGATTTATTGAAAACAGAGGACCATGGAGATGGTTTTCTAGAACAA
CAAGAAGATCGGGAATATCCAAGTAGAGCTGCTCAAGATCAATTTTGGGG
CTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy