Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR51 IGR53 IGR55 IGR54 IGR56 IGR52 IGR50 CPn0068 CPn0063 CPn0064 CPn0067 CPn0062 CPn0065 CPn0066 CPn0069 CPn0068 CPn0063 CPn0064 CPn0067 CPn0062 CPn0065 CPn0066 CPn0069 CPn0068 CPn0064 CPn0067 CPn0062 CPn0065 CPn0066 CPn0069 CPn0063
* Calculated from Protein Sequence

Gene ID: CPn0066

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
80925

Gene Stop:
82658

Gene Length:
1734

Molecular Weight*:
65101

pI*:
7.40

Net Charge*:
2.73

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0066 is weakly similar to CT326, a predicted hypothetical protein. Residues 75-330 are 24% similar to CT326.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0066 is paralogously related to CPn0381 and 0069, both hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
70
non-globular  
349  
521

PDB Hit:


Gene Protein Sequence:
MANPTQSRPPSPEISIEELELQELAGSSNTETISNTPPPSCAATAEEVSL
FIEGGRRNSEDEEGPLGSCEVYDVVCITNQGDPEVRDHEVRVMYINGSGR
TQHEGILDAMNICDLRGEPVRFIHNSGYGLGSCFLGIRNRIPPRDNVISQ
AIQARWNEFFIFAENANRDYIVLFSGNGGLYLQVALDNSIYSHHILCVGI
GSSYYIQGNYRVHNYRVTGDWTTLLDRRGATAVNTTTLPYADSAEGLFLP
SVRCPSYQWALRCGEQCLIMDNNQQVGFRPQDSSSEIALVVNLNQDHSTW
TRLIEWIDRGDSQAVLELNPQPSHCRDIALTALYATTRISSLLQECLMIS
VTYAPEVFVTYAIVTGYSIMTLRYFILLLTNRPGCRRHFRVLRLAALGLQ
SLGFLTVLLDHINVTRRVNRRPPLISVIFCTASFATGSFIYVDLTRMFFT
SLRSRLQLFVQRRLTGRGLPLRRVFVNHLDSLRFSQNALITFHGGLFMPL
IIGFFNQLVIQVPRVVIRPNTTAVYDLNQTSQEAWDSGDVLAIGQTINFL
LCMILLVINTFFFVRSVRRNLHRRPHR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAATCCCACACAATCGCGACCACCGAGTCCGGAGATAAGTATAGA
AGAACTAGAGCTTCAAGAACTTGCAGGATCCTCGAATACTGAGACTATTT
CTAATACACCTCCCCCGTCATGCGCTGCTACTGCCGAAGAAGTATCTCTT
TTTATTGAGGGAGGCCGTAGAAACTCAGAAGATGAGGAGGGACCTCTAGG
ATCTTGTGAGGTGTACGATGTTGTCTGTATAACAAACCAAGGAGATCCTG
AGGTTAGAGATCACGAAGTCAGAGTTATGTACATTAACGGCAGCGGTCGA
ACACAACATGAGGGTATTCTTGATGCTATGAACATCTGTGATCTCAGAGG
AGAACCCGTCAGGTTCATACACAATAGTGGGTATGGTTTAGGGAGCTGCT
TCTTAGGGATTCGAAATCGTATTCCTCCTAGAGATAATGTTATTAGCCAA
GCAATACAAGCACGATGGAATGAGTTTTTTATTTTCGCAGAAAATGCAAA
TCGAGATTACATCGTTCTTTTCTCTGGTAATGGAGGTCTCTATCTTCAAG
TCGCTTTAGATAACTCCATATACTCACATCATATTCTTTGTGTTGGCATT
GGAAGCAGTTATTATATCCAAGGAAATTATCGTGTTCACAACTACCGTGT
GACAGGGGATTGGACGACCCTCCTGGATCGTCGGGGGGCAACAGCAGTAA
ATACTACAACGTTGCCTTATGCAGATTCTGCTGAAGGACTCTTTTTACCC
TCAGTACGCTGTCCCTCATACCAATGGGCATTGCGTTGTGGAGAACAGTG
CCTGATCATGGATAACAACCAACAAGTTGGGTTTCGCCCCCAAGATTCCT
CTTCAGAAATCGCCTTAGTAGTAAATTTAAATCAGGACCACAGCACCTGG
ACTCGTCTGATTGAATGGATAGATCGGGGGGATTCTCAGGCTGTTCTAGA
ATTGAATCCTCAACCGAGTCATTGTCGTGATATTGCATTGACTGCACTAT
ACGCTACAACAAGGATTTCTTCTTTACTTCAAGAGTGCCTAATGATTTCT
GTGACTTATGCTCCAGAGGTTTTCGTCACCTATGCTATCGTTACAGGATA
CTCTATAATGACCTTGCGCTATTTTATTCTATTATTAACAAATCGTCCAG
GCTGCCGGCGGCATTTTCGTGTTTTAAGATTAGCGGCTTTAGGGTTGCAG
TCCTTAGGATTTTTGACTGTATTGCTTGATCATATCAATGTAACACGGAG
AGTCAATCGCCGCCCCCCCTTAATATCAGTAATCTTCTGTACTGCTAGTT
TTGCCACAGGAAGTTTCATTTATGTAGACTTAACACGCATGTTTTTCACG
AGCTTACGTTCGCGCTTGCAATTGTTTGTTCAAAGAAGATTAACAGGAAG
AGGTCTACCACTGAGAAGGGTTTTTGTAAATCACCTAGACTCTTTGAGAT
TTTCTCAAAATGCTTTGATAACCTTTCATGGGGGACTTTTTATGCCTCTC
ATAATAGGTTTTTTTAATCAGCTGGTCATTCAGGTTCCTCGAGTTGTCAT
CAGACCAAATACCACTGCCGTTTATGATCTCAACCAGACCTCACAGGAAG
CGTGGGACTCTGGAGACGTATTAGCTATAGGACAGACCATAAACTTCTTG
CTTTGCATGATTCTATTGGTCATCAATACCTTTTTCTTCGTGAGATCCGT
ACGAAGGAATTTGCATCGTAGACCTCATCGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy