Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR48 IGR51 IGR49 IGR53 IGR55 IGR54 IGR52 IGR50 CPn0068 CPn0063 CPn0064 dut, - CPn0059 ptsN, - CPn0060 ptsN, - CPn0061 CPn0067 CPn0062 CPn0065 CPn0066 CPn0068 CPn0063 CPn0064 dut, - CPn0059 ptsN, - CPn0060 ptsN, - CPn0061 CPn0067 CPn0062 CPn0065 CPn0066 CPn0068 CPn0064 dut, - CPn0059 ptsN, - CPn0060 ptsN, - CPn0061 CPn0067 CPn0062 CPn0065 CPn0066 CPn0063
* Calculated from Protein Sequence

Gene ID: CPn0065

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
78924

Gene Stop:
80654

Gene Length:
1731

Molecular Weight*:
64909

pI*:
5.80

Net Charge*:
-7.66

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0065 is similar to CT288: residues 11-503 of CPn0065 are 23% similar to residues 13-512 of CT288, a hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
35  
161
non-globular  
207  
296
coil-coil  
364  
398

PDB Hit:


Gene Protein Sequence:
MTDFPTHFKGPKLNPIKVNPNFFERNPKVARVLQITAVVLGIIALLSGIV
LIIGTPLGAPISMILGGCLLASGGALFVGGTIATILQARNSYKKAVNQKK
LSEPLMERPELKALDYSLDLKEVWDLHHSVVKHLKKLDLNLSKTQREVLN
QIKIDDEGPSLGECAAMISENYDACLKMLAYREELLKEQTQYQETRFNQN
LTHRNKVLLSILSRITDNISKAGGVFSLKFSTLSSRMSRIHTTTTVILAL
SAVVSVMVVAALIPGGILALPILLAVAISAGVIVTGLSYLVRQILSNTKR
NRQDFYKDFVKNVDIELLNQTVTLQRFLFEMLKGVLKEEEEVSLEGQDWY
TQYITNAPIEKRLIEEIRVTYKEIDAQTKKMKTDLEFLENEVRSGRLSVA
SPSEDPSETPIFTQGKEFAKLRRQTSQNISTIYGPDNENIDPEFSLPWMP
KKEEEIDHSLEPVTKLEPGSREELLLVEGVNPTLRELNMRIALLQQQLSS
VRKWRHPRGEHYGNVIYSDTELDRIQMLEGAFYNHLREAQEEITQSLGDL
VDIQNRILGIIVEGDSDSRTEEEPQE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGATTTTCCTACTCACTTCAAAGGACCCAAACTTAACCCCATTAA
AGTAAATCCAAACTTTTTTGAGAGGAATCCTAAAGTCGCAAGGGTACTGC
AAATTACAGCCGTAGTCTTAGGAATCATTGCCCTCTTATCCGGTATAGTA
CTCATTATAGGCACCCCTCTCGGAGCTCCTATAAGTATGATCCTCGGCGG
ATGTCTTTTAGCTTCTGGAGGCGCCTTATTTGTTGGTGGTACGATTGCTA
CGATATTGCAAGCTAGAAATAGTTATAAGAAGGCCGTGAACCAAAAGAAA
CTCTCAGAGCCTTTGATGGAACGCCCCGAATTGAAAGCCTTAGATTATTC
CCTAGATCTGAAAGAGGTATGGGACCTACATCATTCTGTTGTCAAACATC
TTAAAAAATTAGACCTGAATCTTTCCAAAACCCAAAGGGAAGTTCTAAAT
CAAATCAAAATTGATGATGAGGGACCCTCCCTAGGGGAATGCGCCGCTAT
GATTTCAGAAAACTACGACGCATGCTTAAAGATGCTCGCGTATCGTGAGG
AGCTCCTGAAAGAACAAACCCAATACCAAGAGACACGATTCAATCAGAAC
CTCACTCATAGAAATAAAGTTTTGCTCTCCATCCTCTCAAGGATCACGGA
CAATATTTCTAAAGCGGGCGGGGTCTTTTCTTTGAAATTTTCCACGCTAA
GCTCGCGGATGTCACGAATTCATACCACCACCACTGTGATTCTGGCTTTA
AGTGCCGTTGTTTCTGTCATGGTCGTAGCAGCTCTAATTCCAGGTGGCAT
TTTAGCACTACCTATACTTTTGGCTGTTGCTATTTCTGCAGGAGTGATTG
TCACCGGACTTTCCTATCTAGTTCGTCAGATTTTAAGTAACACCAAGCGT
AATCGTCAGGATTTTTATAAAGATTTTGTAAAAAATGTAGATATAGAGCT
TCTTAACCAAACGGTAACTTTACAGCGATTCCTCTTTGAAATGCTCAAAG
GTGTTCTGAAAGAAGAAGAAGAAGTCTCCTTAGAAGGTCAAGATTGGTAT
ACACAATACATAACCAATGCACCCATAGAAAAAAGATTGATCGAAGAGAT
CAGAGTTACCTACAAAGAGATCGATGCTCAGACCAAAAAAATGAAGACAG
ACTTGGAGTTCTTAGAAAATGAGGTGCGTTCCGGGAGACTGTCTGTAGCG
TCCCCGTCGGAAGATCCAAGTGAAACTCCTATTTTTACTCAAGGTAAGGA
GTTTGCAAAGTTACGTCGCCAAACCTCTCAGAATATATCCACGATTTATG
GTCCGGACAATGAAAATATTGATCCCGAATTTTCCTTACCCTGGATGCCT
AAAAAAGAAGAAGAAATAGACCATAGCTTAGAACCTGTTACAAAGTTGGA
ACCCGGTTCAAGAGAAGAGTTGTTGTTGGTAGAGGGGGTCAACCCAACCT
TAAGAGAACTCAATATGAGAATTGCACTTCTACAACAACAACTATCAAGT
GTCCGAAAATGGAGACACCCTCGAGGGGAACATTACGGGAATGTTATCTA
TTCAGATACAGAACTCGATCGTATTCAGATGCTAGAAGGCGCATTTTATA
ATCACCTCAGGGAAGCTCAAGAGGAAATCACCCAGTCTCTCGGAGACCTT
GTTGACATTCAAAACCGTATTTTAGGGATCATAGTTGAAGGGGACTCAGA
TTCAAGAACAGAAGAAGAGCCTCAGGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy