Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR48 IGR46 IGR51 IGR45 IGR49 IGR53 IGR54 IGR52 IGR50 CPn0063 CPn0064 dut, - CPn0059 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0067 CPn0062 CPn0065 CPn0066 CPn0063 CPn0064 dut, - CPn0059 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0067 CPn0062 CPn0065 CPn0066 CPn0064 dut, - CPn0059 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0067 CPn0062 CPn0065 CPn0066 CPn0063
* Calculated from Protein Sequence

Gene ID: CPn0063

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
78112

Gene Stop:
78270

Gene Length:
159

Molecular Weight*:
5862

pI*:
8.50

Net Charge*:
3.26

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
32  
49

PDB Hit:


Gene Protein Sequence:
MYANCKHNCLCLYDFSRHRSPPGLPLTFTPPYSFTLGIFLGRCLSTSNIV
LL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATGCGAATTGTAAGCACAATTGTCTCTGTCTTTATGATTTTAGCAG
ACATCGTTCTCCTCCTGGGCTCCCTCTTACTTTTACCCCTCCTTATAGTT
TTACTTTGGGAATCTTCTTAGGAAGATGCCTTTCTACGTCTAATATTGTT
TTATTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy