Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR48 IGR46 IGR51 IGR45 IGR49 IGR44 IGR53 IGR52 IGR50 CPn0063 CPn0064 dut, - CPn0059 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 CPn0066 mrsA, - CPn0056 CPn0063 CPn0064 dut, - CPn0059 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 CPn0066 mrsA, - CPn0056 CPn0064 dut, - CPn0059 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 CPn0066 mrsA, - CPn0056 CPn0063
* Calculated from Protein Sequence

Gene ID: CPn0062

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
76308

Gene Stop:
77693

Gene Length:
1386

Molecular Weight*:
50811

pI*:
10.80

Net Charge*:
37.56

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0062 is orthologously related to CT289, a hypothetical protein: residues 113-448 are 34% similar to residues 52-363 of CT289.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
28
non-globular  
29  
195
coil-coil  
256  
283
transmembrane  
425  
442

PDB Hit:


Gene Protein Sequence:
MMSSKRTSKIAVLSILLTFTHSIGFANANSSVGLGTVYITSEVVKKPQKG
SERKQAKKEPRARKGYLVPSSRTLSARAQKMKNSSRKESSGGCNEISANS
TPRSVKLRRNKRAEQKAAKQGFSAFSNLTLKSLLPKLPSKQKTSIHEREK
ATSRFVNESQLSSARKRYCTPSSAAPSLFLETEIVRAPVERTKELQDNEI
HIPVVQVQTNPKEQNTKTTKQLASQASIQQSEGTEQSLRELAQGASLPVL
VRSNPEVSVQRQKEELLKELVAERRQCKRKSVRQALEARSLTKKVARGGS
VTSTLRYDPEKAAEIKSRRNCKVSPEAREQKYSSCKRDARANGKQDKTTP
SEDASQEEQQTGAGLVRKTPKSQVASNAQNFYRNSKNTNIDSYLTANQYS
CSSEETDWPCSSCVSKRRTHNSISVCTMVVTVIAMIVGALIIANATESQT
TSDPTPPTPTP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAGCTCTAAGCGTACCTCGAAAATAGCGGTGCTTTCAATTTTATT
AACATTTACTCACTCTATAGGGTTCGCAAATGCGAATTCGTCCGTAGGTC
TTGGCACGGTCTACATTACATCCGAGGTTGTAAAGAAGCCTCAGAAAGGA
TCAGAAAGGAAACAAGCCAAAAAAGAACCTCGTGCTCGTAAAGGATACTT
AGTCCCTTCTTCAAGGACTCTTTCAGCTCGAGCCCAAAAGATGAAAAACT
CCTCTCGTAAAGAGTCTTCAGGTGGTTGTAACGAAATTTCTGCAAATTCT
ACACCCAGATCTGTAAAATTACGAAGAAACAAACGTGCAGAACAAAAGGC
AGCTAAACAAGGATTTTCAGCTTTTTCTAACCTAACTTTGAAAAGCCTAC
TTCCTAAACTTCCTTCAAAACAAAAAACTTCAATTCACGAGAGAGAAAAA
GCAACCTCAAGATTTGTTAATGAGTCTCAGCTTAGTTCCGCACGAAAACG
CTACTGCACACCATCTTCAGCCGCTCCTTCCCTATTTTTAGAAACAGAAA
TCGTTCGAGCTCCTGTAGAAAGAACTAAAGAACTTCAAGATAATGAAATT
CATATTCCTGTAGTGCAAGTCCAAACGAACCCCAAAGAACAAAATACAAA
GACAACTAAACAGTTGGCATCCCAAGCCTCGATTCAACAATCTGAAGGAA
CCGAGCAATCATTGCGAGAGCTCGCCCAAGGTGCTAGCCTACCTGTCTTA
GTGCGCTCTAATCCTGAAGTGTCTGTACAAAGACAAAAAGAAGAGTTATT
AAAAGAACTCGTAGCTGAACGTAGACAATGTAAAAGAAAGTCTGTAAGAC
AAGCTCTTGAAGCTCGTTCTTTAACTAAGAAAGTTGCTAGAGGCGGTTCT
GTGACCTCGACTTTACGATACGATCCAGAAAAAGCGGCGGAAATCAAAAG
TAGACGCAATTGCAAAGTAAGTCCTGAAGCACGTGAACAAAAATATTCAT
CTTGCAAAAGAGATGCTCGCGCTAATGGGAAACAAGACAAGACAACTCCT
AGTGAAGATGCTTCTCAAGAAGAACAACAAACTGGGGCAGGACTCGTACG
CAAGACTCCTAAATCTCAGGTTGCAAGTAATGCTCAGAACTTCTACCGAA
ATTCTAAAAATACAAACATAGATAGCTATCTTACAGCTAACCAATACAGC
TGTAGTTCTGAAGAAACAGATTGGCCATGTTCTTCCTGCGTCTCTAAACG
CAGAACTCACAACAGTATATCTGTATGTACCATGGTAGTTACTGTCATTG
CGATGATCGTAGGGGCTTTGATTATAGCTAATGCTACAGAATCTCAAACA
ACATCAGATCCAACTCCTCCAACTCCTACTCCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy