Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR48 IGR46 IGR51 IGR45 IGR49 IGR42 IGR44 IGR52 IGR43 IGR50 rnc, - CPn0054 CPn0063 CPn0064 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 mrsA, - CPn0056 rnc, - CPn0054 CPn0063 CPn0064 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 mrsA, - CPn0056 rnc, - CPn0054 CPn0064 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 mrsA, - CPn0056 CPn0063
* Calculated from Protein Sequence

Gene ID: CPn0059

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dut  

Definition:
deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)

Gene Start:
74616

Gene Stop:
75053

Gene Length:
438

Molecular Weight*:
15330

pI*:
4.80

Net Charge*:
-4.57

EC:
3.6.1.23  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Comment:
DUTPase and DUTP pyrophosphatase produces dUMP, a precursor
to all thymidine nucleotides. The E.coli enzyme, typically a
homotrimer, has a characterized 3D structure.

Blast Summary:  PSI-Blast Search
CPn0059 is similar to CT292,a predicted dut deoxyuridine 5'-triphosphate nucleotidohydrolase:
residues 1-143 are 69% similar to CT292. CPn0059 is also similar to
TP0885, a predicted dut protein.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 9 to 143 (E-value = 5.8e-31) place CPn0059 in the dUTPase family which is described as dUTPase (PF00692)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
81

PDB Hit:


Gene Protein Sequence:
MTVFCELDSGGELPEYTTPGAAGADLRANIEEPIALLPGQRALIPTGIKA
EIPEGYELQVRPRSGLALKHGITVLNSPGTIDSDYRGEIRVILINFGDST
FIIEPKMRIAQVVLSPVVQATFVVKQESLAETARGSGGFGHTGAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGTATTTTGTGAATTGGATTCAGGAGGAGAACTTCCTGAATATAC
TACGCCAGGAGCCGCTGGTGCGGATCTTAGGGCAAACATCGAAGAACCCA
TCGCTCTGCTGCCTGGACAACGTGCTTTGATCCCTACCGGAATCAAAGCA
GAAATTCCCGAAGGGTACGAGCTACAGGTCCGTCCTCGGAGCGGTTTGGC
TTTAAAGCACGGCATTACTGTTTTAAATTCCCCAGGGACTATCGATTCAG
ATTATAGGGGAGAGATTCGTGTAATCTTAATCAACTTCGGTGATAGTACA
TTCATTATTGAACCTAAGATGCGGATAGCTCAAGTTGTTTTATCTCCTGT
AGTACAGGCAACGTTTGTTGTTAAGCAAGAAAGTTTAGCGGAAACTGCCC
GAGGAAGTGGAGGTTTTGGTCATACTGGAGCAAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy