Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR48 IGR46 IGR51 IGR45 IGR49 IGR42 IGR44 IGR52 IGR43 IGR50 radA,sms, - CPn0053 CPn0063 CPn0064 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 mrsA, - CPn0056 radA,sms, - CPn0053 CPn0063 CPn0064 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 mrsA, - CPn0056 rnc, - CPn0054 rnc, - CPn0054 radA,sms, - CPn0053 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 CPn0065 mrsA, - CPn0056 CPn0064 CPn0063
* Calculated from Protein Sequence

Gene ID: CPn0058

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accD  

Definition:
acetyl-CoA carboxylase subunit beta

Gene Start:
73639

Gene Stop:
74565

Gene Length:
927

Molecular Weight*:
34044

pI*:
6.80

Net Charge*:
-0.63

EC:
6.4.1.2  

Functional Class:
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Carbohydrate Metabolism; Pyruvate metabolism
Lipid Metabolism; Fatty acid biosynthesis (path 1)
Propanoate metabolism

Comment:
The acetyl-CoA carboxlase subunit is part of the hexaheteromeric
enzyme complex that transfers a carboxyl group to the carrier protein
then a transcarboxylation step for malonyl-CoA formation.

Blast Summary:  PSI-Blast Search
CPn0058 is orthologously related to CT293: residues 1-308 of CPn0058 are 84% similar to residues 1-308 of CT293, a predicted acetyl-CoA carboxylase/transferase beta from C. trachomatis.
No similarity to T.pallidum, M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
113  
131
transmembrane  
210  
228

PDB Hit:


Gene Protein Sequence:
VRLFSYDKPKIKVQKIKADGFSGWLKCNHCHEMIHANELGQNYNCCPKCS
YHYRITAIERVKLLADKDSWRPLYTDLKSQDPLEFIDTDTYANRLEKARK
NTTESEGVIVGICTIGLHPVALAVMDFNFMAGSMGAVVGEKLTRLIEEAI
ETRLPVIIVSASGGARMQESVFSLMQMVKTSAALAKLHEAGLPYISVLTN
PTSGGVTASFAALGDIIIAEPKALICFAGPRVVAQVIGEDLPEGAQKSEF
LLEHGMIDKIVERKELKTTLQTLLDYFLAQEYTGGKSKAPRDLSKRLKEI
FLLTDDSE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTCTATTTTCTTACGACAAACCCAAGATTAAAGTGCAAAAAATCAA
GGCAGATGGTTTTAGTGGTTGGCTCAAGTGTAATCATTGTCACGAGATGA
TTCACGCAAATGAGCTAGGACAAAATTATAATTGTTGTCCTAAGTGCTCC
TATCATTACCGTATTACTGCGATCGAAAGAGTCAAGCTGCTTGCAGACAA
AGATTCTTGGCGTCCTCTTTATACGGATCTGAAATCCCAAGATCCCTTGG
AATTTATAGATACCGATACCTACGCAAATCGCCTAGAAAAAGCTCGAAAG
AATACTACAGAAAGCGAAGGCGTCATTGTAGGTATATGTACTATAGGCCT
CCACCCCGTAGCCCTCGCCGTTATGGATTTCAATTTTATGGCAGGATCTA
TGGGTGCTGTTGTAGGGGAGAAACTGACCAGACTTATAGAGGAAGCCATT
GAAACCAGGCTCCCTGTAATTATTGTCAGCGCTTCTGGAGGCGCACGTAT
GCAGGAATCTGTATTTTCTTTAATGCAGATGGTGAAGACCTCAGCAGCTC
TTGCTAAGCTTCATGAAGCAGGTCTACCCTATATTTCAGTCCTCACCAAC
CCAACTTCAGGTGGAGTGACAGCCTCTTTCGCTGCCCTCGGTGATATTAT
AATAGCAGAACCTAAAGCACTGATTTGTTTCGCAGGACCTCGAGTCGTCG
CTCAGGTGATAGGAGAAGATCTCCCCGAAGGGGCTCAAAAATCTGAATTC
CTACTAGAACATGGCATGATTGATAAAATCGTTGAGCGTAAAGAATTGAA
AACCACCCTTCAGACTTTACTTGATTACTTTTTAGCCCAAGAATACACTG
GCGGGAAAAGTAAAGCTCCTAGAGATCTTTCGAAAAGGCTTAAAGAGATT
TTTTTGTTGACAGATGACAGTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy