Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR48 IGR46 IGR45 IGR49 IGR42 IGR44 IGR43 IGR50 radA,sms, - CPn0053 CPn0063 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 mrsA, - CPn0056 radA,sms, - CPn0053 CPn0063 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 mrsA, - CPn0056 radA,sms, - CPn0053 rnc, - CPn0054 rnc, - CPn0054 CPn0063 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 mrsA, - CPn0056
* Calculated from Protein Sequence

Gene ID: CPn0057

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sodM  sodA  

Definition:
superoxide dismutase precursor

Gene Start:
72934

Gene Stop:
73557

Gene Length:
624

Molecular Weight*:
23526

pI*:
5.80

Net Charge*:
-5.88

EC:
1.15.1.1  

Functional Class:
cellular processes; detoxification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to eukaryotic superoxide dismutase sequences; e.g. residues 6-202 are 56% similar to SODM_CAEEL; residues 6-201 are 55% similar to SODM_MOUSE; and residues 6-200 are 55% similar to SODM_RAT.
Residues 1-203 are 73% similar to CT294, a predicted superoxide dismutase precursor sequence. No significant similarity to M.genitalium, T.pallidum, U.urealyticum, or M.pneumoniae.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
Residues 8-193 span four regions of similarity to blocks BL00088A-D (Manganese and iron superoxide dismutases proteins) with a combined E-value of 2.4e-78.

ProDom Summary:  Protein Domain Search
Residues 6-202 are 56% similar to a defined domain of SODM_CAEEL, defined as: SUPEROXIDE DISMUTASE OXIDOREDUCTASE MANGANESE MN IRON PRECURSOR TRANSIT PEPTIDE FE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 86 (E-value = 3.7e-43) place CPn0057 in the Sod_Fe_N family which is described as Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081)
Residues 92 to 200 (E-value = 3.2e-48) place CPn0057 in the Sod_Fe_C family which is described as Iron/manganese superoxide dismutases, C-terminal domain (PF02777)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
35  
64

PDB Hit:


Gene Protein Sequence:
MSFVPYSLPELPYDYDALEPVISSEIMILHHQKHHQIYINNLNAALKRLD
AAETQQNLNELIALEPALRFNGGGHINHSLFWETLAPIDQGGGQPPKHEL
LSLIERFWGTMDNFLKKLIEVAAGVQGSGWAWLGFCPAKQELVLQATANQ
DPLEPLTGKLPLLGVDVWEHAYYLQYKNVRMDYLKAFPQIINWGHIENRF
SEIISSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTTTGTTCCTTATTCTTTACCAGAGTTACCCTATGATTATGACGC
TTTGGAGCCTGTAATTTCTTCTGAAATTATGATTTTACACCACCAAAAGC
ATCATCAGATCTACATTAATAATCTTAACGCGGCTTTGAAGAGATTAGAT
GCTGCAGAAACACAACAAAACCTTAATGAACTCATTGCTTTAGAACCCGC
TCTCCGCTTTAACGGGGGAGGACACATCAACCACTCTCTATTCTGGGAAA
CTCTTGCTCCTATCGATCAAGGGGGAGGACAGCCTCCAAAACATGAGCTC
CTTTCTCTTATTGAAAGATTTTGGGGTACGATGGACAACTTTTTAAAAAA
ATTAATCGAAGTTGCTGCAGGAGTTCAAGGCTCCGGTTGGGCCTGGCTAG
GATTTTGTCCCGCAAAACAAGAACTTGTCTTACAAGCAACAGCAAATCAG
GATCCTCTAGAGCCTCTCACAGGGAAACTCCCTCTGCTTGGCGTGGATGT
TTGGGAGCACGCCTATTACCTGCAATATAAAAATGTTCGTATGGATTATT
TAAAAGCCTTTCCTCAAATAATTAATTGGGGACATATAGAAAATAGATTT
TCTGAAATAATATCATCTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy