Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR48 IGR46 IGR45 IGR49 IGR42 IGR44 IGR41 IGR43 radA,sms, - CPn0053 CPn0051 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 mrsA, - CPn0056 radA,sms, - CPn0053 CPn0051 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 mrsA, - CPn0056 radA,sms, - CPn0053 hemC, - CPn0052 rnc, - CPn0054 hemC, - CPn0052 rnc, - CPn0054 CPn0051 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 ptsN, - CPn0061 accD, - CPn0058 CPn0062 mrsA, - CPn0056
* Calculated from Protein Sequence

Gene ID: CPn0056

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mrsA  

Definition:
phosphomannomutase

Gene Start:
70953

Gene Stop:
72749

Gene Length:
1797

Molecular Weight*:
66823

pI*:
5.50

Net Charge*:
-15.04

EC:
5.4.2.8  

Functional Class:
energy metabolism; sugars  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannosemetabolism

Comment:
Phosphomannomutase converts mannose-1-phosphate
to mannose-6-phosphate.

Blast Summary:  PSI-Blast Search
CPn0056 is similar to TP0642 in T. pallidum,
MG053 in M. genitalium and UU530 in U. urealyticum.

CPn0056 is orthologously related to CT295:
residues 1-592 are 56% similar to residues
1-587 of CT295.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0056 appears to be paralogously related
to CPn0967, thought to be Phosphoglucomutase.

Pfam Summary:  Pfam Search
Residues 54 to 198 (E-value = 8.9e-57) place CPn0056 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)

PDB Hit:


Gene Protein Sequence:
MKEVEQRIRSLYDAVTAENICRWLSNDCTQQDAKTILGWLDTDPAQLEDL
FGATLTFGTGGLRSLMGIGTNRINLFTIRRTTQGLVQVLRAHLPHPGDPM
RVVVGCDTRHNSIEFAQETAKVLAGNGCEVFLFQYPEPLALVSFTVRYER
AIGGVMITASHNPPNYNGYKVYMASGGQVLPPLDQEIVAACSAVNEILSV
PSIDHPNIHLIGKEYEALYRDTLKQLQLYPEANRISGRSLSISYSPLHGT
GISLVPHVLKDWGFLSVHLVEKQAIGDGDFPTVQLPNPEDPEALTLGIEQ
MLANDDDLFIATDPDADRVGVVCLEDGQPYRFNGNQMASLLADHILGAWS
KTRHLGEHDKLVKSLVTTEMLSAIAKHYHVDLINVGTGFKYIGEKIESWR
NSTNKFVFGAEESYGCLYGTHVEDKDAIIASALIAEAALQQKLQGKTLCD
ALLSLYETYGYFANKTESVVFSAKTDEQEIRKKLSHLEEISSANFFSGKY
QVEKFENYKQGIGFNLLSKDSYALTLPKTSMLCYYFSGGGRVIIRPSGTE
PKIKFYFEMSTHYPERVTDKEIQKQREAESFQHLDDFIFDFKEKFSNL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAAGTAGAACAACGTATCCGGTCATTATACGATGCAGTAACAGC
TGAAAATATTTGTAGATGGTTGTCCAATGATTGTACCCAACAAGATGCAA
AGACTATCCTAGGATGGTTAGATACAGATCCTGCACAGCTTGAAGATCTA
TTCGGAGCGACTCTTACCTTTGGTACCGGAGGACTCCGTAGTCTTATGGG
TATCGGAACAAATAGGATCAACCTGTTTACTATACGTCGAACGACGCAAG
GGCTGGTTCAGGTGCTCCGCGCTCATCTTCCCCATCCCGGAGATCCTATG
CGTGTAGTTGTCGGTTGTGATACCCGCCATAACTCTATAGAATTTGCTCA
AGAAACTGCAAAAGTCCTCGCAGGTAATGGCTGCGAAGTTTTCTTGTTTC
AGTATCCCGAACCTTTGGCTTTAGTCTCCTTTACGGTGAGATACGAAAGG
GCCATCGGCGGAGTGATGATCACCGCCTCTCATAATCCTCCCAATTACAA
TGGGTATAAAGTTTATATGGCTTCGGGAGGCCAAGTTCTCCCTCCCTTAG
ATCAAGAGATTGTTGCCGCCTGTAGTGCAGTGAACGAAATTTTATCAGTG
CCCTCGATAGATCATCCCAATATTCACCTCATTGGAAAAGAATACGAAGC
CCTTTACAGAGACACTTTGAAGCAACTGCAACTCTATCCCGAAGCAAACC
GGATTTCAGGAAGGTCTTTATCTATTTCCTATTCGCCATTGCATGGAACA
GGAATTTCTCTCGTTCCTCATGTTCTCAAAGACTGGGGATTTTTATCCGT
ACATCTTGTGGAAAAACAGGCCATAGGTGACGGCGATTTCCCAACCGTGC
AGCTGCCAAATCCTGAGGATCCAGAGGCTCTGACTCTGGGCATTGAGCAA
ATGCTCGCTAATGACGATGATCTTTTTATAGCTACCGACCCAGATGCCGA
TCGCGTGGGCGTGGTTTGTCTAGAAGACGGCCAACCCTACCGATTTAACG
GAAATCAAATGGCGAGCCTTTTAGCAGACCACATCTTAGGAGCTTGGAGC
AAAACAAGACACTTAGGAGAACATGATAAATTGGTCAAGAGCTTGGTGAC
TACAGAAATGCTCTCTGCTATCGCAAAGCACTATCATGTGGATCTTATTA
ATGTCGGAACAGGATTTAAATACATCGGAGAGAAAATTGAATCCTGGCGC
AATTCCACAAACAAATTCGTATTTGGAGCCGAGGAATCTTACGGTTGTCT
CTACGGCACTCACGTAGAAGATAAAGACGCTATTATTGCGTCAGCATTGA
TTGCAGAAGCCGCACTACAACAAAAATTACAAGGAAAAACTCTATGCGAC
GCACTCCTTTCTCTTTACGAAACATACGGATACTTTGCTAACAAAACGGA
GTCTGTGGTTTTTTCCGCAAAAACTGACGAACAAGAAATAAGAAAAAAAC
TTTCACACCTTGAGGAAATCAGTTCTGCGAATTTTTTCTCAGGGAAATAC
CAAGTAGAGAAATTTGAAAACTATAAGCAAGGGATAGGTTTCAATCTTCT
ATCGAAGGATTCCTACGCCCTCACCCTGCCTAAAACATCTATGCTCTGTT
ATTATTTTAGTGGGGGAGGTCGGGTAATCATACGACCCTCAGGAACAGAA
CCTAAAATCAAGTTCTACTTCGAAATGTCAACTCATTATCCAGAGCGCGT
TACCGATAAAGAAATACAAAAACAACGTGAAGCAGAGAGTTTTCAACATT
TAGACGATTTTATTTTTGATTTTAAAGAGAAATTTTCCAATTTGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy