Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR47 IGR38 IGR40 IGR46 IGR45 IGR42 IGR44 IGR41 IGR39 IGR43 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0051 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 accD, - CPn0058 mrsA, - CPn0056 CPn0048 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0051 dut, - CPn0059 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 accD, - CPn0058 mrsA, - CPn0056 CPn0048 CPn0049 radA,sms, - CPn0053 hemC, - CPn0052 rnc, - CPn0054 hemC, - CPn0052 rnc, - CPn0054 CPn0050 CPn0051 CPn0055 ptsN, - CPn0060 sodM,sodA, - CPn0057 accD, - CPn0058 mrsA, - CPn0056 CPn0048 dut, - CPn0059
* Calculated from Protein Sequence

Gene ID: CPn0055

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
70129

Gene Stop:
70593

Gene Length:
465

Molecular Weight*:
17707

pI*:
7.10

Net Charge*:
0.35

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0062 is orthologously related to CT296, a hypothetical protein: residues 1-152 are 48% similar to CT296.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MRSALHLQHLRHFHNHGSILFENLLTIKDCFLLETKLQNFIAKASKTIDT
VRWRENIFRSMPEIYTVVRKRRLDFFAAELVHRPKLSLVRDLWVFPGEEI
LEGEEDCMLFLLLSGDRAGSGIFFTGPYPSDLYELEKGTTGLLLAFSSVG
IPVI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGTCTGCTCTACACCTCCAACACTTGCGCCATTTCCATAACCACGG
CTCTATTTTATTTGAAAATCTTCTGACTATAAAAGATTGTTTTTTATTAG
AAACAAAATTACAAAATTTTATTGCCAAAGCATCAAAAACTATAGACACT
GTGCGGTGGAGAGAGAATATATTTCGCTCAATGCCAGAGATTTATACAGT
CGTTCGTAAACGGCGTTTGGATTTCTTTGCAGCGGAATTGGTGCACCGCC
CCAAGCTTTCCCTCGTTCGAGATCTCTGGGTCTTCCCAGGAGAAGAGATC
CTTGAAGGAGAAGAAGATTGCATGCTTTTCCTTTTACTTTCAGGAGATCG
TGCAGGAAGCGGTATATTCTTTACAGGACCCTATCCTTCAGATCTTTATG
AATTGGAGAAGGGAACTACGGGGTTGCTTTTAGCTTTCTCTTCTGTAGGG
ATTCCAGTAATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy