Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR38 IGR40 IGR46 IGR45 IGR42 IGR44 IGR41 IGR39 IGR43 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0051 dut, - CPn0059 CPn0055 sodM,sodA, - CPn0057 accD, - CPn0058 mrsA, - CPn0056 CPn0048 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0051 dut, - CPn0059 CPn0055 sodM,sodA, - CPn0057 accD, - CPn0058 mrsA, - CPn0056 CPn0048 CPn0049 radA,sms, - CPn0053 hemC, - CPn0052 rnc, - CPn0054 hemC, - CPn0052 rnc, - CPn0054 CPn0050 CPn0051 dut, - CPn0059 CPn0055 sodM,sodA, - CPn0057 accD, - CPn0058 mrsA, - CPn0056 CPn0048
* Calculated from Protein Sequence

Gene ID: CPn0054

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnc  

Definition:
ribonuclease III, dsRNA-specific

Gene Start:
70023

Gene Stop:
69310

Gene Length:
714

Molecular Weight*:
26073

pI*:
5.20

Net Charge*:
-4.37

EC:
 

Functional Class:
transcription; RNA processing  

Pathway: pathway table

Comment:
Ribonuclease III digests double-stranded RNA. It is similar to proteins involed in the processing of ribosomal RNA precursors and of some mRNAs.
Endonucleolytic cleavage to 5'-phospho-monoester.


Blast Summary:  PSI-Blast Search
CPn0054 is orthologously related to CT297: residues 1-231 of CPn0054 are 65% similar to residues 1-231 of CT297, RIBONUCLEASE III from C. trachomatis.
CPn0054 is similar to TP0809.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 45 to 135 (E-value = 3.1e-45) place CPn0054 in the Ribonuclease_3 family which is described as RNase3 domain (PF00636)
Residues 161 to 227 (E-value = 2.8e-20) place CPn0054 in the dsrm family which is described as Double-stranded RNA binding motif (PF00035)

PDB Hit:


Gene Protein Sequence:
MHPPIDITAIEAKLNFTFTQPKLLEIALTHPSYKNESAVQIEDSERLEFL
GDAVLGLIVTEHLFLLFPSMDEGTLSTARASLVNAKACCRYTTMLGIGDY
LLIGKGEKIQSERGRLSAYANLFESILGAVYLDGGLSPARKLTVPLLPPR
EEILPLMSGNPKNLLQQFTQKQFRVLPVYQSTAVTDAQGNVSYQIQVLVN
QEVWGEGNASSKKEAEKIAAQQALDTYGNKNQNTMDV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATCCCCCTATAGACATCACGGCTATTGAAGCTAAGTTAAATTTTAC
ATTTACACAACCTAAGCTCTTAGAAATAGCGCTGACTCACCCCTCATATA
AAAACGAGTCGGCGGTGCAAATTGAAGATAGTGAGCGTTTAGAATTTTTA
GGAGATGCTGTCCTTGGTCTCATTGTTACTGAGCATCTTTTTCTTCTCTT
TCCTTCGATGGATGAGGGAACTCTATCCACGGCACGGGCTTCTTTAGTGA
ATGCAAAAGCGTGCTGTCGTTATACAACCATGCTAGGGATTGGGGATTAT
CTTCTTATAGGAAAAGGGGAAAAAATCCAGAGTGAGCGAGGACGTCTTTC
TGCCTATGCCAATCTATTTGAATCTATTTTAGGTGCTGTGTATTTGGATG
GGGGTCTTTCTCCAGCTAGGAAACTTACGGTTCCCCTCCTTCCTCCTAGA
GAAGAAATTCTTCCTTTAATGTCTGGCAATCCTAAGAACCTTCTTCAGCA
GTTCACACAAAAGCAGTTTCGCGTTCTTCCGGTATATCAATCCACGGCAG
TTACGGATGCTCAAGGAAATGTCAGTTACCAGATCCAGGTTCTTGTGAAT
CAAGAGGTTTGGGGAGAGGGAAATGCGTCATCCAAAAAGGAAGCAGAAAA
AATTGCAGCACAACAGGCACTAGATACGTATGGCAACAAAAACCAAAACA
CAATGGACGTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy