Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR38 IGR40 IGR37 IGR42 IGR41 IGR36 IGR39 IGR43 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0055 CPn0045 mrsA, - CPn0056 CPn0048 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0055 CPn0045 mrsA, - CPn0056 CPn0048 CPn0049 radA,sms, - CPn0053 hemC, - CPn0052 rnc, - CPn0054 hemC, - CPn0052 rnc, - CPn0054 CPn0050 CPn0051 CPn0055 mrsA, - CPn0056 CPn0048 CPn0046 CPn0045 CPn0047 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0052

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemC  

Definition:
porphobilinogen deaminase

Gene Start:
68005

Gene Stop:
67301

Gene Length:
705

Molecular Weight*:
26229

pI*:
8.20

Net Charge*:
6.51

EC:
4.3.1.8  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; heme, porphyrin and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Comment:
The HEM3 protein in E.coli catalyzes one or more steps in the porphyrin
biosynthesis pathway. A 3D structure is available.

Blast Summary:  PSI-Blast Search
CPn0052 is similar to CT299, a predicted porphobilinogen deaminase:
residues 1-226 are 53% similar to CT299. It is also similar to HEM3_CLOJO.
No similarity to T.pallidum, M.genitalium or U.urealyticum.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
Residues 21-43 and 138-181 are similar to blocks BL00533A and C, concerned
with porphobilinogen deaminase cofactor-binding site proteins, e.g. HEM3_ECOLI,
HEM3_BACSU.

ProDom Summary:  Protein Domain Search
Residues 52-192 are 39% similar to a porphobilinogen deaminase
domain as seen in HEM3_CLOJO.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 20 to 227 (E-value = 1.7e-15) place CPn0052 in the Porphobil_deam family which is described as Porphobilinogen deaminase, dipyromethane cofactor binding domain (PF01379)

PDB Hit:


Gene Protein Sequence:
MLSVCYSDPCLSDFCQGKRPLRIASRNSNLAKAQVHECISLLRSWYPKLW
FQLSTTETTGDREKKIPLHLVENSYFFTDGVDALVHKGVCDLAIHSAKDL
PETPSLPVVAITRCLHPADLLVYADHYVHEPLPLSPRLGSSSLRRSAVLK
QLFPQGQILDIRGTIEERLDQLHRGHYDAIVLAKAASLRLHLHHAYSIEL
PPPYHALQGSLAITAKDHAGKWKQLFTPIHCHSS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTATCCGTCTGTTACTCTGACCCCTGTTTAAGTGATTTCTGTCAGGG
CAAGCGCCCCCTTCGTATTGCTTCTAGAAATTCAAATTTAGCGAAAGCTC
AAGTACATGAGTGTATTTCTTTGCTGCGCTCGTGGTATCCCAAACTTTGG
TTCCAGTTAAGCACTACAGAGACTACTGGGGATCGTGAGAAGAAAATCCC
CTTACATCTTGTAGAAAACTCTTATTTTTTCACTGATGGCGTCGATGCCT
TAGTCCATAAAGGAGTCTGCGATCTGGCGATACACTCTGCTAAGGATCTT
CCTGAGACTCCCTCTCTTCCTGTAGTTGCCATAACACGATGTCTACATCC
TGCAGACCTGTTAGTGTATGCTGACCACTATGTTCATGAGCCCCTACCCT
TGAGTCCCCGGCTAGGGAGTTCTTCTCTACGTCGAAGTGCAGTACTAAAA
CAACTGTTTCCTCAAGGACAGATCTTGGATATTCGAGGCACTATTGAAGA
GAGGCTGGATCAGCTCCACCGTGGTCATTATGATGCTATTGTTCTTGCGA
AAGCTGCGAGTTTAAGACTTCACCTGCATCATGCTTATAGTATAGAACTT
CCTCCTCCATACCATGCCCTACAAGGATCCTTAGCAATTACAGCCAAGGA
TCACGCAGGTAAATGGAAACAGTTATTTACCCCTATACACTGCCACTCCT
CATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy