Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR38 IGR40 IGR37 IGR42 IGR41 IGR36 IGR39 IGR43 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0055 CPn0045 mrsA, - CPn0056 CPn0048 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0055 CPn0045 mrsA, - CPn0056 CPn0048 CPn0049 radA,sms, - CPn0053 hemC, - CPn0052 rnc, - CPn0054 hemC, - CPn0052 rnc, - CPn0054 CPn0050 CPn0051 CPn0055 CPn0045 mrsA, - CPn0056 CPn0048 CPn0046 CPn0047 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0050

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
66813

Gene Stop:
66496

Gene Length:
318

Molecular Weight*:
11570

pI*:
9.60

Net Charge*:
5.98

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:
No PROSITE patterns correspond to this protein sequence.

Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
51  
75

PDB Hit:


Gene Protein Sequence:
MRYAKHQTNWNDENVKANLGYLPSTNCKNALCRMSSRLTSSIKTAGILGG
CGILLPIFLLLLAILLISVLFQLIMLPFRLCCFALRQSVSSDTVTNLLLL
NNTLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGATATGCAAAGCATCAAACAAACTGGAATGACGAGAATGTCAAGGC
TAACTTAGGCTATCTCCCCTCTACTAACTGCAAAAATGCGCTATGTAGGA
TGTCATCTAGACTGACAAGCTCTATAAAGACCGCTGGAATTCTTGGTGGA
TGTGGAATCCTTCTCCCTATATTTCTTCTGCTCCTAGCTATCCTACTTAT
TTCTGTGCTTTTTCAGTTAATCATGTTGCCATTTCGCCTTTGTTGCTTTG
CTTTGCGTCAATCAGTGTCCTCTGATACTGTTACAAATTTATTGTTGCTA
AATAACACCTTGGCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy