Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR38 IGR40 IGR37 IGR34 IGR41 IGR36 IGR39 IGR35 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0044 CPn0045 CPn0043 CPn0048 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0044 CPn0045 CPn0043 CPn0048 CPn0049 radA,sms, - CPn0053 hemC, - CPn0052 rnc, - CPn0054 hemC, - CPn0052 rnc, - CPn0054 CPn0050 CPn0051 CPn0045 CPn0043 CPn0048 CPn0046 CPn0047 CPn0044 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0048

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
63687

Gene Stop:
65804

Gene Length:
2118

Molecular Weight*:
79081

pI*:
8.00

Net Charge*:
10.42

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few significant hits over last half of sequence; e.g. residues 431-692 are 40% similar to YQFF_BACSU, defined as: hypothetical 79.2 kD protein in hoH-DgkA intergenic region. Residues 431-686 are 36% similar to (AE001239) conserved hypothetical integral membrane protein [Treponema pallidum], also identified as TP0651; residues 429-696 are 32% similar to Y104_SYNY3, a hypothetical 90.3 KD protein; and residues 431-507 are 38% similar to (U29177) unknown [Bacillus subtilis].

No significant similarity to C.trachomatis, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 222-692 are 31% similar to a defined domain of YQFF_BACSU, defined as: Protein transmembrane slr0104 PhoH-DgkA intergenic region.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 480 to 625 (E-value = 1.9e-26) place CPn0048 in the HD family which is described as HD domain (PF01966)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
44
transmembrane  
261  
278
transmembrane  
298  
322
transmembrane  
330  
354
transmembrane  
368  
385
transmembrane  
397  
414
transmembrane  
431  
449

PDB Hit:


Gene Protein Sequence:
MKELRHESYNRALHKLSHQWVRYFLYTFVSCSFIVAIFTFAWLKVLYVPE
YKAGEISRISLTAPMDFSLSWSAHKFYKRTAHISEAFGKVYHLTLSPGSL
LSKEGNADENTDYWFKKAADFLLSTNFVDSSTQKCLKDLCIYPPLLGKEK
KTLEININSNKGNVIAQCFCHLKIFLIQENCPQPCFDAIMDILKIANFEV
AVDKEMSGCVKGELLGKRCIEKITKGTPILEKYQRIDDRDAKILKQLRAQ
LLSVHTLFSCRSLWGAIFVVLLILLWGYGALKALCPEMLKSPQRFMLYIA
ILTLSLLWCRGTEIFCAYWVSYLSYPPILPFTAVLLGYFLGLPIAGFSCT
FLALLYTLGSDLWNNSWFLSINLLCSWRILVSLHRVSRLSSVFWACMKLG
GVAMGSLLMFRIFTNTISREALYADGIESFVYSLITAISVVALIPVFEAS
FGASTNFSLLTYLSPENALLKRLFKEAPGTYQHSVLVGSLAEAAAQAIGA
DSLYCLVAAHYHDIGKLINPGFFSENQKILQQSGHSLSPLECAKMIMRHI
PEGVNLARQAGLPESFIQVIEEHHGTSVIRSAYYSHMVENPSTGSFDEEL
FRYSGNKPSSKETTIIMIADSFEAASRSLKNASLPDLQRLIDQIIQGKLQ
DGQFSCSPITLDELALISKSMVQTLYGALHSRMKYPEISYQISMDSCPKP
SIGGT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAACTTAGACATGAATCCTATAACCGTGCATTACATAAGCTAAG
CCATCAATGGGTTCGCTACTTTCTCTATACTTTCGTATCGTGTTCCTTCA
TAGTCGCCATATTTACTTTTGCATGGTTAAAGGTCCTCTATGTTCCCGAA
TATAAGGCTGGTGAGATCTCACGTATTTCTCTGACAGCTCCTATGGATTT
TTCTTTAAGTTGGAGCGCTCATAAATTTTATAAACGTACTGCCCACATTT
CAGAAGCCTTTGGGAAGGTCTATCATCTTACACTCTCTCCCGGTAGTCTC
CTCAGCAAAGAGGGGAACGCCGATGAAAACACTGACTATTGGTTTAAAAA
AGCAGCTGATTTTTTGTTGTCTACCAACTTTGTCGATAGTTCAACTCAAA
AATGTCTTAAGGACTTGTGTATATATCCTCCTTTATTGGGGAAAGAAAAG
AAAACCTTAGAAATCAATATCAACTCGAATAAAGGGAATGTTATTGCTCA
GTGCTTCTGCCACTTAAAAATTTTTCTTATACAAGAAAATTGTCCCCAGC
CCTGTTTTGATGCAATCATGGATATTTTGAAGATCGCCAACTTCGAAGTG
GCCGTGGATAAGGAAATGTCAGGTTGTGTGAAAGGAGAGCTTCTCGGAAA
ACGTTGCATTGAGAAAATTACCAAGGGCACACCTATATTAGAAAAGTATC
AGAGAATCGATGATCGGGATGCTAAAATTCTAAAGCAGCTTCGAGCGCAA
CTCCTTTCAGTGCATACCTTATTTTCCTGTAGATCCTTATGGGGGGCTAT
TTTTGTAGTTTTACTCATACTTCTATGGGGCTACGGTGCTTTGAAAGCCC
TGTGTCCTGAGATGTTGAAATCTCCCCAGCGCTTTATGCTCTATATTGCG
ATTCTAACTCTTTCGTTGCTGTGGTGCAGAGGGACAGAAATCTTTTGCGC
CTATTGGGTTTCCTATCTATCTTACCCACCGATTTTACCATTTACAGCTG
TACTCCTAGGATATTTTCTAGGTCTTCCCATAGCAGGATTTTCCTGTACG
TTTCTTGCCCTTCTCTACACCTTGGGATCCGATCTTTGGAATAATAGTTG
GTTTCTATCTATAAACCTACTTTGTTCTTGGAGAATCTTAGTGAGCTTAC
ATCGCGTCAGTCGCCTTTCTTCGGTGTTTTGGGCGTGTATGAAACTTGGA
GGCGTAGCTATGGGAAGCCTGCTCATGTTTCGGATATTTACAAATACAAT
ATCAAGAGAAGCCCTATATGCTGATGGGATCGAAAGCTTCGTTTATAGTC
TGATCACCGCAATCAGCGTTGTTGCTTTGATCCCTGTCTTCGAGGCTTCT
TTCGGAGCTTCTACAAACTTTTCGCTCCTCACCTATTTATCTCCCGAAAA
CGCATTGCTGAAGCGTCTTTTCAAAGAAGCTCCAGGTACCTACCAGCATT
CCGTATTAGTTGGAAGCTTAGCAGAAGCTGCAGCTCAAGCTATAGGTGCA
GATAGCCTCTATTGCTTGGTTGCAGCTCATTACCATGATATCGGGAAACT
GATTAATCCAGGATTTTTCAGTGAAAATCAAAAAATCTTACAACAATCTG
GTCATTCGCTATCCCCATTAGAGTGCGCTAAGATGATTATGCGCCATATT
CCTGAAGGGGTGAATCTTGCTAGGCAGGCAGGGCTTCCTGAGTCTTTTAT
CCAGGTGATAGAAGAGCATCACGGAACCTCTGTGATCCGCTCAGCATACT
ACAGCCATATGGTAGAGAACCCTTCTACAGGGAGCTTTGATGAGGAATTA
TTCCGATATTCTGGAAATAAACCCTCCTCTAAAGAAACTACAATCATTAT
GATCGCGGATTCTTTTGAAGCAGCCTCGCGATCTCTAAAAAATGCCAGTC
TTCCAGATCTCCAAAGACTCATCGATCAGATTATCCAAGGGAAGTTACAA
GACGGTCAGTTTTCTTGTTCTCCAATTACGTTAGATGAACTCGCTTTGAT
TAGCAAGAGCATGGTGCAAACCCTCTACGGAGCTCTACATTCTCGGATGA
AATACCCTGAAATATCGTATCAAATTTCTATGGATTCCTGCCCCAAACCC
TCTATAGGAGGAACTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy