Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR38 IGR40 IGR37 IGR34 IGR41 IGR36 IGR39 IGR33 IGR35 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0044 CPn0042 CPn0045 CPn0043 CPn0048 CPn0050 CPn0049 radA,sms, - CPn0053 CPn0047 CPn0051 CPn0044 CPn0042 CPn0045 CPn0043 CPn0048 CPn0049 hemC, - CPn0052 radA,sms, - CPn0053 CPn0050 hemC, - CPn0052 CPn0051 CPn0044 CPn0042 CPn0045 CPn0043 CPn0048 CPn0046 CPn0047 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0046

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
62790

Gene Stop:
63266

Gene Length:
477

Molecular Weight*:
18670

pI*:
6.10

Net Charge*:
-0.89

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of C.pneumoniae.
No significant similarity to C.trachomatis, M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous significantly paralogous sequences found in C.pneumoniae, all of which are predicted hypothetical proteins. In order of similarity they are: CPn0044, CPn0042, CPn0010.1, CPn1054, CPn0009, and CPn1056.

Residues 41-153 are 75% similar to residues 1-113 of CPn0044.
Residues 1-136 are 56% similar to residues 124-259 of CPn0042.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
97  
132

PDB Hit:


Gene Protein Sequence:
LNQDLQNVYQECQKATGLESEVSAYRDHLREQITEFETQGLDVIKEELLF
VSSTLKSKLSYDPLIADIPCMKFYEEYYDGIDKARVQSRWLEKSERYRKA
KKGFQEMLKEGLFKEDQALKKAEYRLLREKRMNKEKLLICNKIEAAQQRV
QEFGPSDS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAATCAGGATTTACAAAATGTATACCAAGAGTGCCAGAAGGCTACAGG
TTTAGAATCGGAAGTGAGTGCATATAGAGATCATCTTAGAGAGCAGATCA
CAGAGTTTGAAACTCAAGGGCTGGACGTGATAAAAGAAGAACTTCTTTTT
GTGAGTAGTACTCTCAAAAGTAAATTGAGCTATGATCCATTAATAGCAGA
CATTCCCTGTATGAAGTTTTATGAGGAGTATTATGATGGCATTGATAAAG
CGAGAGTTCAATCCCGATGGCTGGAGAAGTCTGAGAGGTATAGAAAGGCG
AAGAAGGGATTCCAAGAGATGCTGAAGGAAGGCCTATTCAAAGAAGATCA
GGCTTTGAAAAAAGCAGAGTATAGATTACTTCGAGAGAAGAGAATGAATA
AGGAGAAGCTTTTGATTTGCAATAAGATAGAAGCAGCTCAGCAGCGAGTC
CAAGAATTTGGACCCTCGGATTCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy