Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR38 IGR40 IGR37 IGR34 IGR32 IGR36 IGR39 IGR33 IGR35 CPn0050 CPn0049 CPn0047 CPn0051 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 CPn0050 CPn0049 CPn0047 CPn0051 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 CPn0049 CPn0050 CPn0051 CPn0044 CPn0041 CPn0045 CPn0043 CPn0048 CPn0046 CPn0047 CPn0042 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0045

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
61069

Gene Stop:
62793

Gene Length:
1725

Molecular Weight*:
65877

pI*:
5.00

Net Charge*:
-17.82

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of C.pneumoniae.
No significant similarity to C.trachomatis, M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous hypothetical protein sequences in C.pneumoniae show probable paralogy. In order of similarity they are: CPn0043, CPn1054, CPn0041, CPn1055, CPn0010, CPn0009, CPn0008, CPn0010.1, CPn0126, CPn0007, CPn0042, CPn0124, and CPn0012.

Residues 1-568 are 71% similar to CPn0043.
Residues 1-568 are 49% similar to CPn1054.

Pfam Summary:  Pfam Search
Residues 1 to 208 (E-value = 2.9e-113) place CPn0045 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
145
coil-coil  
374  
475

PDB Hit:


Gene Protein Sequence:
VLLLISGALFLTLGVPGLAAGLSFGLGIGLSALGGVLVVSGLLFFLIRRG
VSKVRPEEIPVTPSHEAQKILCQLPQELDQLDTSIQEVVSCLGKLKDLKY
EDQGLLTEVQEKLRVFDFVRKDMVTEFLELQQVVAQEGQFLDYLINQVQS
ISHKLFVPDVNIGAHLAELCGYLPSGDVRVERLKRSARQVVDRFMRVTCD
TRKVAMAFDENACGVAKNAFDKAFGALEECVYKSLTESYREAFYEYEKAK
ILRNEDVEWLQDKNKSARAEQRFREVKDRWEDLKETVFWVKENGCIDLEV
LTAVGGWPDRGPEHLIPEKRRNKVMSHKLWEATMRMKGAEGTYSVARVAF
EKDGSRKNQKKFQEKTKEWLRCLKDLHDQECHRARERLAELEALYPEVSV
SVVETERETKFKLETAYGNLEERYQSVVRDQEDYWKEEENKEAEFREKGT
KVRSPEEVVEYLQILENLSEDCSKQLTIAEVVVLGVELEATAEFEYTILS
DAANRLKVLCEDIEDILPRVEEIEIMLRIAELPFLPIKQAFTKAFLQYNS
CKDKLAKVEPYCQESVDYKSGFRV$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTTTACTGATTTCAGGAGCTCTCTTTCTAACGTTGGGAGTTCCAGG
ACTTGCTGCAGGGCTCTCTTTTGGATTAGGCATCGGTCTCTCCGCATTAG
GAGGCGTACTGGTTGTTTCAGGACTTCTATTCTTTCTCATAAGACGAGGG
GTTTCGAAAGTTCGTCCAGAAGAGATTCCTGTGACTCCTTCCCATGAAGC
CCAGAAGATTTTATGTCAGCTACCTCAGGAACTGGATCAGTTAGATACGT
CTATTCAGGAAGTAGTCTCATGTTTAGGGAAACTGAAAGATCTTAAGTAC
GAAGATCAAGGGCTTTTAACAGAGGTACAGGAGAAACTTCGAGTTTTTGA
CTTTGTCAGGAAAGACATGGTGACAGAGTTTTTAGAGCTACAGCAGGTTG
TGGCTCAAGAAGGACAATTTCTAGATTACCTAATCAATCAGGTGCAAAGC
ATATCACACAAACTTTTTGTACCTGATGTAAATATTGGAGCTCATTTAGC
GGAGTTGTGTGGGTATTTACCTTCTGGTGATGTTCGAGTGGAGCGTTTAA
AGAGATCTGCTCGTCAGGTTGTAGATCGCTTTATGAGGGTGACTTGTGAC
ACGCGGAAGGTGGCAATGGCTTTTGACGAGAATGCCTGTGGAGTGGCAAA
AAATGCCTTTGATAAGGCTTTTGGGGCATTAGAAGAGTGTGTGTATAAGA
GTCTGACAGAGAGTTATAGAGAGGCATTTTATGAATATGAGAAGGCGAAG
ATCCTTAGGAATGAAGATGTAGAATGGCTGCAGGATAAGAATAAGAGCGC
ACGTGCTGAGCAGAGATTTAGGGAAGTCAAGGATCGTTGGGAGGACTTAA
AGGAAACGGTCTTTTGGGTAAAAGAAAACGGTTGTATTGACCTAGAAGTG
CTCACTGCAGTGGGTGGGTGGCCAGATCGTGGTCCAGAGCATCTTATTCC
TGAAAAAAGAAGGAATAAGGTAATGAGCCATAAATTATGGGAGGCGACTA
TGCGAATGAAGGGAGCAGAAGGAACGTATAGTGTAGCAAGAGTCGCCTTT
GAAAAGGATGGATCTAGAAAGAATCAGAAGAAATTCCAAGAAAAGACAAA
AGAGTGGTTGCGATGTTTAAAGGATTTGCATGATCAGGAGTGTCATCGTG
CACGGGAGAGATTGGCAGAACTTGAAGCTTTGTATCCTGAGGTTTCAGTC
TCTGTAGTAGAGACGGAGAGAGAGACAAAATTTAAATTAGAGACTGCTTA
TGGGAATCTCGAAGAGCGCTATCAGAGCGTTGTGCGAGATCAGGAGGACT
ACTGGAAAGAAGAAGAAAACAAGGAAGCAGAGTTTAGGGAAAAAGGAACA
AAGGTTCGCTCTCCAGAGGAGGTGGTAGAGTATCTTCAGATCTTAGAAAA
TCTGTCGGAAGACTGTTCTAAGCAATTAACTATAGCGGAAGTGGTTGTCT
TAGGTGTAGAGCTGGAAGCTACAGCAGAGTTCGAGTATACCATACTCTCT
GATGCAGCGAATCGTCTTAAGGTTTTATGTGAAGATATTGAGGACATCCT
GCCTCGAGTCGAAGAAATAGAAATCATGCTACGTATAGCAGAGCTTCCAT
TCCTTCCTATAAAGCAAGCATTTACTAAGGCCTTTTTACAATATAACAGC
TGTAAAGATAAGTTAGCAAAGGTGGAGCCCTACTGTCAGGAGAGCGTGGA
CTATAAGAGCGGTTTCAGAGTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy