Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR37 IGR34 IGR32 IGR36 IGR33 IGR35 IGR31 dnaX, - CPn0040 CPn0047 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 dnaX, - CPn0040 CPn0047 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 dnaX, - CPn0040 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 CPn0046 CPn0047 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0044

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
60419

Gene Stop:
60781

Gene Length:
363

Molecular Weight*:
14604

pI*:
10.40

Net Charge*:
7.95

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those within C.pneumoniae.
No significant similarity to C.trachomatis, M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous hypothetical protein sequences show significant similarity. In order of similarity they are: CPn0044, CPn0046, CPn0042, CPn1054, CPn0010.1, CPn0009, CPn1056, and CPn0126.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
57  
120

PDB Hit:


Gene Protein Sequence:
VSLIKEELLFLSSTLKSKLSYDPLIANIPCMKFYYQYYDDIDKARAQSRW
LEKSERYRNAKRRFQEIVKKGLFKEAKPLKKEEYRLLQEERSNKEKRLIY
NKMAVARQRVQEFESMEIPE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGCTTGATAAAAGAAGAGCTTCTCTTTTTAAGCAGTACTCTCAAAAG
TAAATTGAGCTATGATCCATTAATAGCAAACATTCCCTGTATGAAGTTTT
ATTACCAGTATTATGATGACATTGATAAAGCGAGAGCTCAATCCCGATGG
CTGGAGAAGTCTGAGAGGTATAGAAATGCTAAGAGGAGATTCCAAGAGAT
CGTGAAGAAAGGCCTATTCAAAGAAGCTAAGCCCTTGAAAAAAGAGGAGT
ATAGGTTACTTCAAGAGGAGAGAAGCAATAAGGAGAAGCGTTTGATTTAC
AATAAGATGGCAGTAGCTCGGCAACGAGTTCAAGAATTTGAATCGATGGA
GATTCCAGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy