Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR37 IGR34 IGR32 IGR36 IGR33 IGR35 IGR31 dnaX, - CPn0040 CPn0047 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 dnaX, - CPn0040 CPn0047 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 dnaX, - CPn0040 CPn0044 CPn0042 CPn0041 CPn0045 CPn0043 CPn0048 CPn0046 CPn0047 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0043

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
58447

Gene Stop:
60375

Gene Length:
1929

Molecular Weight*:
73790

pI*:
6.30

Net Charge*:
-4.82

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
This is a C. pneumoniae-specific protein with no similarity to a known sequence in any other organisms.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0043 is paralogously related to CPn0045, CPn1054, CPn0041, CPn1055, CPn0009, CPn0010, CPn0008, CPn0007, CPn0042, CPn0126, CPn0124, CPn0012, CPn0011, CPn1056, all predicted hypothetical proteins from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 39 to 257 (E-value = 1.1e-119) place CPn0043 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
30  
53
transmembrane  
58  
76
non-globular  
77  
164
coil-coil  
422  
471

PDB Hit:


Gene Protein Sequence:
MQVPLSPQLPPPPPDHSVGASFCLSKFRVLAITFLVLGVLLLISGALFLT
LGISGVSLGVGLGLSALGSVLVISGFLLLLERREVSGVGLEGIPTGIPVG
PSAEPSSEEIQKKQKAKQILDQLPQELDQLDTDIQHVLSCLGKLKDLKCK
DRGLLKDAKEKLQVFDFVWKDMMMEFVELQQVMDQESRYLEGLIHEVQSI
AHKLFVDDVNIRSHLGESCGYLPSEDVRGELLKRFAKEVVARFMKVTRDI
RKIAMAFNKNAYGAAKNAFDKAFGSLETCLYKSLTKSYRDTFCDYKRAKI
LPDENNSARAEQRFREVKDHWEDLKETVFWVKEDGRIDIEVLTAVGGWPD
RYPEHLILEKRKDKVMSHQLWEATMRVKEAEVTYSVARVAFEKDGSQQNQ
KKFQEKTKERLRCLKDLRDQECHRAQERLEKLTALYPEVSVSVVETERER
KFNLEKAYGNLEERYQSVVQDQEDYWTEQKNREAEFRAKGTKVRSMEEVA
EHLQILENLLEDCYKRLSKAETFALGVEREATEEIEYTILSDAANRLKVL
CEDIEDTLPRVEEIEMMLRMAERPLHPIKQAFTKAFVQYNRCKERLAKVE
PYYKESPAYVNSEERLQSLDQASQCIQRVPKGFKFRNGSMYI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGTACCTCTATCACCACAGCTACCCCCCCCCCCCCCAGACCACTC
TGTAGGGGCTTCTTTTTGTCTGTCTAAATTTCGTGTTTTAGCAATCACTT
TTTTAGTTCTTGGTGTGCTCTTACTGATTTCAGGAGCTCTCTTTCTAACG
TTAGGGATTTCAGGAGTCTCTCTTGGAGTTGGTTTGGGGCTCTCTGCATT
AGGAAGTGTACTCGTTATTTCGGGATTTCTATTGCTTTTAGAAAGACGAG
AGGTTTCGGGAGTGGGTTTAGAGGGGATTCCGACAGGTATTCCTGTGGGT
CCTTCTGCAGAACCTTCTTCAGAGGAAATACAGAAGAAGCAAAAAGCAAA
GCAAATTTTAGATCAACTGCCTCAGGAACTAGATCAGTTAGATACGGATA
TTCAGCACGTGCTCTCATGTTTAGGGAAACTGAAAGATCTTAAGTGCAAA
GATCGAGGTCTTTTAAAAGATGCCAAGGAGAAACTGCAAGTTTTTGACTT
TGTTTGGAAAGACATGATGATGGAGTTTGTAGAGCTACAGCAGGTCATGG
ATCAAGAGAGCCGGTATCTAGAGGGCCTGATCCATGAGGTACAAAGTATA
GCACACAAACTTTTTGTAGATGATGTAAATATTAGATCCCATTTAGGGGA
GTCGTGCGGGTATTTACCTTCCGAGGATGTTCGAGGGGAACTGTTAAAGA
GATTCGCTAAAGAGGTCGTAGCTCGCTTTATGAAAGTGACTCGCGACATA
CGGAAGATAGCAATGGCTTTTAACAAAAATGCCTATGGGGCAGCAAAAAA
TGCCTTTGATAAGGCTTTTGGAAGCTTGGAAACGTGTCTGTATAAGAGTC
TGACTAAGAGTTATAGAGATACCTTTTGTGACTATAAGAGAGCAAAGATC
CTTCCGGATGAGAATAATAGCGCTCGTGCCGAGCAAAGGTTTAGGGAAGT
CAAGGATCATTGGGAGGACTTAAAGGAAACGGTCTTTTGGGTAAAAGAAG
ACGGTCGTATTGACATAGAAGTGCTCACTGCAGTCGGTGGGTGGCCAGAT
CGTTATCCAGAGCATCTTATTCTTGAAAAAAGAAAGGATAAGGTAATGAG
CCATCAGTTGTGGGAGGCGACTATGCGTGTGAAAGAAGCTGAAGTAACGT
ATAGTGTAGCAAGAGTCGCCTTTGAAAAGGATGGATCTCAGCAGAATCAG
AAGAAATTCCAAGAAAAGACAAAAGAGAGGCTGCGATGTTTAAAGGATTT
GCGTGATCAGGAGTGTCATCGTGCACAAGAGAGATTAGAAAAACTGACGG
CTTTGTATCCTGAGGTTTCAGTCTCTGTAGTAGAGACGGAGAGAGAGAGG
AAATTTAATTTAGAGAAAGCCTATGGGAATCTCGAAGAGCGCTATCAGAG
CGTTGTGCAAGATCAAGAGGACTACTGGACAGAACAAAAGAACAGGGAAG
CAGAATTTAGGGCGAAAGGAACTAAGGTTCGCTCTATGGAGGAGGTGGCA
GAGCATCTTCAGATCTTAGAAAATCTATTGGAAGACTGTTATAAGAGATT
ATCAAAAGCAGAAACTTTTGCCTTAGGGGTGGAGAGGGAAGCTACAGAAG
AGATAGAGTATACCATACTCTCTGATGCAGCGAACCGTCTTAAGGTTTTA
TGTGAAGATATTGAGGACACCCTGCCTCGAGTCGAAGAAATAGAGATGAT
GCTGCGTATGGCAGAGCGTCCACTCCATCCTATAAAGCAAGCATTTACCA
AGGCTTTTGTACAATATAACAGGTGCAAAGAGAGGTTAGCAAAGGTAGAG
CCCTATTATAAAGAGAGCCCTGCATATGTAAATAGCGAAGAGCGATTGCA
GAGTTTGGATCAGGCTTCACAGTGCATACAAAGAGTCCCAAAAGGTTTCA
AGTTTAGAAACGGAAGCATGTACATATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy