Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR34 IGR32 IGR30 IGR29 IGR33 IGR35 IGR31 ybaB, - CPn0039 dnaX, - CPn0040 CPn0044 CPn0042 CPn0041 ptsI, - CPn0038 CPn0045 CPn0043 ybaB, - CPn0039 dnaX, - CPn0040 CPn0044 CPn0042 CPn0041 ptsI, - CPn0038 CPn0045 CPn0043 ybaB, - CPn0039 dnaX, - CPn0040 CPn0044 CPn0042 CPn0041 ptsI, - CPn0038 CPn0045 CPn0043 CPn0046 CPn0046
* Calculated from Protein Sequence

Gene ID: CPn0042

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
57403

Gene Stop:
58185

Gene Length:
783

Molecular Weight*:
31119

pI*:
5.40

Net Charge*:
-6.23

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST other than to C.pneumoniae sequences.
No significant similarity to C.trachomatis, M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous hypothetical protein sequences show significant paralogy. In order of similarity they are: CPn0042, CPn1054, CPn0010.1, CPn0009, CPn1056, CPn0043, CPn0046, CPn0045, CPn0126, CPn0044, and CPn0012.

Residues 2-259 are 50% similar to residues 498-762 of CPn1054.
Residues 2-259 are 50% similar to residues 146-410 of CPn0010.1.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
28
coil-coil  
45  
72
coil-coil  
114  
169
coil-coil  
197  
245

PDB Hit:


Gene Protein Sequence:
MEEVSEYLQQVENQLESCSKRLTKMETFALGVRLEAKEEIESIILSDVVN
RFEVLCRDIEDMLSRVEEIERMLRMAELPLLPIKEALTKAFVQHNSCKEK
LTKVEPYFKESPAYLTSEERLQSLNQTLQRAYKESQKVSGLESEVRACRE
QLKDQVRQFETQGVSLIKEEILFVTSTFRTKFSYHSFRLHVPCMRLYEEY
YDDIDLERTRARWMAMSERYRDAFQAFQEMLKEGLVEEAQALRETEYWLY
REERKSKKKH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGGAGGTGTCTGAGTATCTTCAGCAAGTAGAAAATCAGTTGGAATC
CTGTTCCAAGCGATTAACCAAGATGGAAACTTTTGCCTTAGGTGTGAGGT
TGGAAGCTAAAGAAGAGATAGAGTCTATCATACTTTCTGATGTAGTGAAC
CGTTTTGAGGTTTTATGTAGAGATATTGAAGATATGCTATCTCGAGTCGA
GGAGATAGAGCGGATGTTACGTATGGCGGAGCTTCCTCTACTTCCTATAA
AAGAAGCGCTTACCAAGGCTTTTGTACAACATAACAGCTGTAAAGAGAAG
TTAACCAAGGTAGAGCCTTACTTTAAAGAGAGCCCTGCATATCTAACTAG
TGAAGAGCGATTGCAGAGTTTGAATCAGACTTTACAACGTGCGTACAAAG
AGTCCCAAAAGGTTTCAGGTTTAGAATCGGAAGTGAGAGCCTGTCGAGAG
CAGCTTAAAGATCAAGTAAGACAGTTTGAAACTCAAGGAGTGAGCTTGAT
AAAAGAAGAGATTCTCTTTGTGACTAGTACCTTTAGAACTAAATTTAGCT
ATCATTCATTTCGATTACATGTTCCTTGCATGAGGTTGTATGAGGAGTAT
TATGATGACATTGATCTAGAGAGAACTCGAGCTCGATGGATGGCGATGTC
TGAGAGGTATAGAGATGCTTTTCAGGCATTCCAGGAGATGTTGAAGGAAG
GCCTAGTTGAAGAAGCTCAGGCTCTTAGAGAAACCGAGTACTGGTTATAT
CGAGAGGAGAGAAAGAGTAAAAAGAAACATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy