Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR34 IGR32 IGR30 IGR29 IGR33 IGR35 IGR31 ybaB, - CPn0039 dnaX, - CPn0040 CPn0044 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0045 CPn0043 ybaB, - CPn0039 dnaX, - CPn0040 CPn0044 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0045 CPn0043 ybaB, - CPn0039 dnaX, - CPn0040 CPn0044 CPn0042 CPn0041 ptsI, - CPn0038 CPn0045 CPn0043 ptsH, - CPn0037 CPn0036 ptsH, - CPn0037
* Calculated from Protein Sequence

Gene ID: CPn0041

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
55996

Gene Stop:
57345

Gene Length:
1350

Molecular Weight*:
52287

pI*:
5.40

Net Charge*:
-10.42

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C. pneumoniae.
No significant hits to C. trachomatis, M. genitalium, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous hypothetical protein sequences in C. pneumoniae show significant paralogy. In order of similarity they are: CPn0045, CPn0043, CPn1054, CPn1055, CPn0010, CPn0008, CPn0126, CPn0007, CPn0009, CPn0010.1, CPn0124, and CPn0011.

Residues 1-449 are 57% similar to CPn0045.
Residues 1-449 are 55% similar to CPn0043.

Pfam Summary:  Pfam Search
Residues 1 to 230 (E-value = 2.4e-100) place CPn0041 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
2  
19
transmembrane  
24  
42
non-globular  
45  
183
coil-coil  
266  
318
coil-coil  
337  
430

PDB Hit:


Gene Protein Sequence:
VLLLISGALFLTLGIPGLTAGVSFGLGIGLSALGGVLVVSGLLCLLVKRE
VSKVCPEEIPAVQPEETPEGVPVTPFEKPALDEAQKEQKTQKILDQLPQE
LDQLDRYIQEAFACLGPLKDLKYEDQGFLQDVKEEFQVFDFVQKDMIAEF
VELQQILCQEGRLLEFVINQTRYIGRDLFKREDSLYKLWEWLGYLPSGDV
RGERLKKSAREVVDRFMRTTCNIRKIAMTFDRHVYSVAKTAFEKAFGALE
TCVYESMRESYREAFCEYEKAKLLGDEEKSAHAEQRFQDIKNRWEDVKDA
FFWVKEDGKIEIDDAIGNSCKWSERYEEHRITRARWYKVAEHQLFNATMR
VKDSLREHNEARVAFEKERSKENQRQVQKKKEKRLRDLKELHDQELPRAQ
ERLRELQALYPEIAVSVVEARREVASDLEKAHESIDKHYQSCVREQELY$


Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTTTACTGATTTCAGGAGCTCTCTTTTTGACGTTGGGGATACCAGG
ACTCACTGCAGGGGTCTCTTTTGGATTAGGTATAGGTCTCTCTGCGTTAG
GAGGAGTGCTTGTTGTCTCAGGACTACTATGCCTTCTAGTAAAACGAGAG
GTTTCGAAAGTATGTCCCGAGGAGATTCCGGCAGTACAACCAGAAGAGAC
TCCTGAAGGGGTTCCTGTGACTCCATTTGAGAAGCCAGCTCTAGATGAAG
CCCAGAAGGAGCAGAAGACTCAGAAAATTTTAGATCAGCTGCCTCAAGAA
TTGGATCAGTTAGATAGGTATATTCAGGAAGCGTTCGCATGTTTAGGACC
GCTGAAAGATCTTAAGTACGAAGATCAAGGTTTTTTACAAGACGTCAAGG
AGGAGTTTCAAGTTTTTGACTTTGTTCAAAAAGATATGATTGCGGAGTTT
GTAGAGCTACAGCAGATTCTATGTCAAGAAGGGAGGTTGCTAGAGTTCGT
AATCAATCAGACACGATATATAGGAAGAGATCTTTTTAAAAGAGAGGATA
GTTTATATAAATTATGGGAATGGCTTGGGTATTTACCTTCTGGGGATGTT
CGAGGGGAGCGGTTAAAGAAATCTGCTCGTGAGGTTGTGGATCGCTTTAT
GAGAACGACTTGTAACATACGGAAGATAGCCATGACTTTTGATAGGCATG
TTTATAGTGTGGCGAAGACGGCCTTTGAAAAGGCATTTGGAGCCTTGGAG
ACGTGTGTGTATGAGAGTATGAGAGAGAGTTATAGAGAGGCATTTTGTGA
GTATGAGAAGGCGAAGCTGCTTGGGGATGAGGAGAAGAGTGCACATGCCG
AGCAAAGGTTTCAGGATATAAAGAACCGTTGGGAGGATGTAAAGGATGCA
TTCTTTTGGGTAAAAGAAGATGGGAAGATTGAAATTGATGATGCAATTGG
AAACAGTTGTAAATGGAGTGAGCGTTATGAAGAGCACAGGATTACTCGAG
CAAGATGGTATAAGGTCGCGGAGCATCAGTTGTTTAATGCGACTATGAGA
GTGAAAGATTCGTTACGAGAGCATAATGAAGCAAGAGTCGCTTTTGAGAA
GGAGAGATCTAAGGAGAATCAGAGGCAAGTCCAAAAAAAGAAAGAAAAGA
GGTTGCGAGATTTAAAGGAATTGCATGATCAGGAGCTTCCGAGAGCACAG
GAGAGGTTGAGAGAGCTGCAAGCTTTGTATCCTGAAATTGCAGTCTCTGT
TGTAGAGGCCAGGAGAGAGGTAGCCTCTGATTTAGAGAAAGCTCATGAGA
GTATTGACAAGCACTATCAAAGCTGTGTTCGAGAGCAAGAGCTCTACTGA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy