Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR32 IGR30 IGR29 IGR33 IGR31 ybaB, - CPn0039 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0043 ybaB, - CPn0039 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0043 ybaB, - CPn0039 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0043 ptsH, - CPn0037 ptsH, - CPn0037
* Calculated from Protein Sequence

Gene ID: CPn0040

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaX  

Definition:
DNA polymerase III subunits gamma and tau

Gene Start:
55643

Gene Stop:
54315

Gene Length:
1329

Molecular Weight*:
49334

pI*:
7.60

Net Charge*:
2.44

EC:
2.7.7.7  

Functional Class:
DNA metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism Nucleotide Metabolism; Pyrimidine metabolism

Comment:
n addition to its replicative function in DNA
synthesis, this enzyme possesses 3' to 5'
exonuclease activity. The tau chain assists in
the dimerization of the core complex. The gamma
chain is an auxillary to the core subunits. In
E.coli, the gamma subunit is encoded by the first
80% of the tau subunit gene, then a frameshifting
event leads to premature termination (Lehninger,
p.823).

Blast Summary:  PSI-Blast Search
CP0040 is similar to TP1005 in T. pallidum,
MG420 in M. genitalium and UU087 in U. urealyticum.

CPn0040 is orthologously related to CT334, a predicted CT334 dnaX DNA polymerase III subunits gamma and tau: residues
6-440 are 57% similar to CT334.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0040 is similar to CPn0272, also a predicted
DNA poly III gamma and tau sequence:

Pfam Summary:  Pfam Search
Residues 43 to 237 (E-value = 1.6e-06) place CPn0040 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

PDB Hit:


Gene Protein Sequence:
MTLQPYQASSRKYRPQIFREILGQSSVVAVLKNALVFNRAAHAYLFSGIR
GTGKTTLARILAKALNCVHLSEDGEPCNQCFSCKEIASGSSLDVLEIDGA
SHRGIEDIRQINETVLFTPVKAKFKIYIIDEVHMLTKEAFNALLKTLEEP
PQHVKFFFATTEIHKIPGTILSRCQKMHLQRIPEKTILEKLSLMAQDDHI
EASQEALAPIARAAQGSLRDAESLYDYVISLFPKSLSPDTVAQALGFASQ
DSLRTLDNAILQRDYATALGIVTDFLNSGVAPVTFLHDLTLFYRNLLLTN
STTSKFSSQYKTEQLLEIIDFLGESAKHLQNTIFEQTFLETVIIHIIRIY
QRPVLSELISSIKSRQFEGLRNIKEPTLTQQVSAPQPQPTYKEQSFLEKK
NQPAAEGKIISVEVKSSASIKSAAVDTLLQFAVVEFSGILRQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCTACAACCCTACCAAGCATCCTCTAGAAAGTACCGTCCACAAAT
CTTTCGAGAAATTCTAGGTCAGAGCTCTGTTGTCGCTGTATTAAAAAATG
CCTTGGTCTTCAACCGAGCCGCCCACGCCTATCTATTTTCTGGAATTCGT
GGTACAGGGAAAACCACACTAGCTCGCATTTTAGCAAAAGCTCTGAACTG
CGTGCATCTTAGCGAGGATGGCGAGCCCTGCAACCAGTGTTTTTCTTGTA
AAGAGATTGCTTCAGGATCCTCTTTAGACGTTTTAGAAATTGACGGAGCC
TCCCACCGTGGTATCGAAGATATCCGTCAAATTAATGAAACTGTATTATT
CACTCCTGTAAAAGCAAAGTTTAAAATTTATATCATAGATGAAGTTCATA
TGCTCACTAAGGAAGCCTTCAATGCTTTATTGAAGACTTTAGAAGAGCCT
CCACAACATGTAAAATTTTTCTTTGCAACTACAGAAATCCATAAAATTCC
CGGAACTATTTTAAGTCGTTGTCAAAAAATGCATCTTCAAAGGATTCCTG
AAAAAACGATCCTGGAGAAGCTATCGCTTATGGCTCAAGATGACCATATT
GAGGCGTCGCAAGAAGCATTGGCGCCGATCGCCCGTGCAGCACAAGGAAG
CTTGCGTGATGCAGAATCTCTTTATGACTACGTAATATCTTTATTTCCTA
AATCTCTCTCTCCCGACACGGTTGCCCAAGCTTTAGGCTTTGCTTCCCAA
GATTCTCTCCGGACTTTAGACAATGCGATTCTTCAAAGGGACTATGCGAC
AGCCTTAGGGATCGTAACGGACTTCTTAAATTCTGGGGTAGCACCTGTCA
CATTTCTCCATGACCTTACATTATTTTATCGTAATCTTCTTCTTACGAAT
TCTACAACAAGCAAGTTCAGCTCTCAGTATAAGACGGAGCAGCTTCTAGA
AATCATAGATTTCCTTGGAGAATCTGCTAAGCACCTACAAAATACCATCT
TCGAACAGACATTTTTAGAAACCGTCATCATTCATATCATTCGCATTTAT
CAAAGGCCTGTTTTATCAGAGTTGATCTCTTCTATTAAGAGTCGGCAGTT
TGAAGGGCTTCGCAATATTAAGGAGCCCACCTTGACGCAGCAAGTATCAG
CTCCTCAACCTCAGCCCACCTACAAAGAACAGAGTTTTTTAGAGAAAAAA
AATCAACCTGCTGCGGAAGGTAAAATTATATCTGTAGAAGTTAAAAGCTC
AGCTTCAATAAAATCTGCAGCTGTAGACACATTATTACAGTTTGCTGTTG
TAGAATTTTCAGGAATTTTAAGACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy