Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR32 IGR30 IGR27 IGR29 IGR33 IGR31 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0043 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0043 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 CPn0043 ptsH, - CPn0037 ptsH, - CPn0037
* Calculated from Protein Sequence

Gene ID: CPn0039

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ybaB  

Definition:
YbaB family hypothetical protein

Gene Start:
54250

Gene Stop:
53960

Gene Length:
291

Molecular Weight*:
10803

pI*:
4.80

Net Charge*:
-3.10

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0039 is orthologously related to CT335: residues 1-96 of CPn0039 are 72% similar to residues 1-96 of CT335, a conserved hypothetical protein (acidic) from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 9 to 93 (E-value = 1.4e-33) place CPn0039 in the DUF149 family which is described as Uncharacterised BCR, YbaB family COG0718 (PF02575)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
30

PDB Hit:


Gene Protein Sequence:
MGSGYAKKKKEAKIMEQQFLEMEASLLEKRYEGQAGNGLVSVVINGKCDL
ISVKVQPTCLDPEDPEVIEDLFRAAFKLAKEQMDQEMSLMRSTMPF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCAGCGGATACGCTAAGAAAAAAAAAGAAGCTAAAATTATGGAACA
GCAATTCCTAGAAATGGAGGCCTCACTATTAGAAAAGCGTTACGAAGGGC
AAGCTGGCAACGGTCTTGTCTCTGTTGTCATCAACGGAAAGTGTGACTTA
ATTTCAGTAAAAGTACAACCTACGTGCTTAGACCCTGAAGATCCAGAAGT
CATTGAAGACTTGTTCCGTGCTGCATTCAAACTTGCAAAAGAGCAGATGG
ATCAAGAAATGTCTCTTATGCGTTCCACAATGCCTTTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy