Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR32 IGR30 IGR27 IGR29 IGR31 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0042 CPn0036 CPn0041 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ptsH, - CPn0037 ptsH, - CPn0037
* Calculated from Protein Sequence

Gene ID: CPn0038

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsI  

Definition:
PEP protein phosphotransferase

Gene Start:
52119

Gene Stop:
53834

Gene Length:
1716

Molecular Weight*:
63499

pI*:
6.50

Net Charge*:
-4.47

EC:
2.7.3.9  

Functional Class:
transport and binding proteins; carbohydrates, organic alcohols and acids  

Pathway: pathway table
Membrane Transport; Phosphotransferase system

Comment:
From Prosite PDOC00527:

This is the first enzyme of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate transport system in bacteria. The PTS catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The general mechanism of the PTS is the following: a phosphoryl group from PEP is transferred to enzyme-I (EI) of PTS which in turn transfers it to a phosphoryl carrier protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to PEP protein phosphotransferase sequences; e.g. residues 11-565 are 30% similar to PT1_BACST; residues 13-563 are 27% similar to PT1_LACSK; and residues 14-564 are 28% similar to PT1_STAAU.

CPn0038 is orthologously related to CT336: residues 10-563 of CPn0038
are 59% similar to residues 13-569 of CT336, a predicted PTS PEP
Phosphotransferase from C. trachomatis.
CPn0038 is also similar to MG429 (residues 13-563 are 28% similar), to MP0215 (residues 3-563 are 26% similar) and to TP0575 (residues 14-566 are 24% similar). No significant similarity to U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
Residues 192-524 span six regions of similarity to blocks BL00370B-G (PEP-utilizing enzymes phosphorylation site proteins proteins) with a combined E-valued of 3.8e-42.

ProDom Summary:  Protein Domain Search
Residues 47-242 are 32% similar to a defined domain of PT1_MYCCA, defined as: PYRUVATE PHOSPHOTRANSFERASE KINASE TRANSFERASE DIKINASE SYSTEM PHOSPHORYLATION ENZYME I SYNTHASE.
Residues 272-449 are 33% similar to a defined domain of O31692_BACSU, defined as: PHOSPHOTRANSFERASE PYRUVATE DIKINASE TRANSFERASE SYSTEM KINASE PHOSPHORYLATION ENZYME I ORTHOPHOSPHATE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 14 to 131 (E-value = 2.7e-09) place CPn0038 in the PEP-utilisers_N family which is described as PEP-utilising enzyme, N-terminal (PF05524)
Residues 151 to 242 (E-value = 2.7e-22) place CPn0038 in the PEP-utilizers family which is described as PEP-utilising enzyme, mobile domain (PF00391)
Residues 259 to 540 (E-value = 9e-47) place CPn0038 in the PEP-utilizers_C family which is described as PEP-utilising enzyme, TIM barrel domain (PF02896)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
45  
72

PDB Hit:


Gene Protein Sequence:
MDTQSSTGNEEWRIAGTSIVSGMALGKVFFLGTSPLHVRELTLPQEEVEH
EIHRYYKALNRSKSDIVALEQEVTGQQGLQEVSSILQAHLEIMKDPLLTE
EVVNTIRKDRKNAEYVFSSVMGKIEESLTAVRGMPSVVDRVQDIHDISNR
VIGHLCCQHKSSLGESDQNLIIFSEELTPSEVASANSAYIRGFVSLVGAA
TSHTAIVSRAKSIPYLANISEELWNIAKRYNGKLVLIDGYRGELIFNPKP
ATLQSCYKKELSVVAHTSQRLVRKSLHPIVSSHAGSDKDVEDLLENFPQT
SIGLFRSEFLAVILGRLPTLREQVDLYEKLARFPGDSPSVLRLFDFGEDK
PCPGIKNKKERSIRWLLDYSVILEDQLQAIAKASLQGSIKVLIPGVSDVS
EIIEVKKKWETIRTRFPKGHKVSWGTMIEFPSAVWMIEEILPECDFLSIG
TNDLVQYTLGISRESALPKHLNVTLPPAVIRMIHHVLQAAKQNQVPVSIC
GEAAGQLSLTPLFIGLGVQELSVAMPVINRLRNHIALLELNSCLEITEAL
LQAKTCSEVEELLNRNNKITS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATACACAGTCCTCTACAGGTAACGAAGAATGGCGTATTGCAGGAAC
CTCTATAGTTTCTGGGATGGCCTTAGGTAAAGTATTTTTTTTGGGAACAT
CCCCCTTGCATGTTCGTGAGCTGACTCTACCTCAAGAAGAAGTCGAACAT
GAAATACATCGTTATTATAAAGCTTTGAATCGCTCGAAGTCTGATATCGT
AGCTTTAGAACAGGAAGTTACGGGACAGCAAGGCCTTCAAGAGGTTTCCT
CTATCCTACAAGCACACTTGGAGATTATGAAAGACCCTCTCCTTACGGAG
GAGGTGGTCAATACTATCCGTAAGGATCGTAAAAATGCAGAATATGTCTT
TTCTTCAGTCATGGGTAAAATAGAAGAGTCGTTAACAGCAGTCCGCGGGA
TGCCTTCTGTTGTAGATCGTGTTCAAGATATCCATGATATCTCCAATAGA
GTTATCGGCCATCTGTGTTGCCAACATAAGAGTTCTTTAGGAGAATCTGA
TCAGAATTTGATCATATTCTCTGAGGAATTGACCCCCTCAGAAGTCGCCA
GTGCTAACTCTGCCTATATCCGAGGGTTTGTCTCATTAGTGGGAGCAGCC
ACATCACATACAGCTATCGTCTCGCGAGCAAAGAGCATTCCCTATCTTGC
TAATATCTCCGAGGAGCTTTGGAACATCGCAAAGCGATATAATGGCAAGT
TAGTCTTAATCGACGGTTATCGTGGAGAGCTAATCTTTAATCCTAAACCA
GCGACTCTACAAAGCTGCTATAAAAAAGAGCTTTCCGTGGTTGCCCATAC
CTCTCAGAGATTAGTAAGAAAGTCCCTACACCCGATTGTTTCTTCGCATG
CAGGCAGTGATAAGGACGTAGAAGATCTATTAGAGAACTTCCCTCAAACC
TCCATAGGCCTCTTTCGTTCTGAGTTTTTAGCTGTAATTTTAGGACGCCT
ACCTACACTAAGAGAGCAAGTAGATCTTTACGAGAAGCTCGCACGTTTTC
CTGGAGATTCGCCCTCAGTACTGCGCCTCTTTGATTTTGGTGAAGACAAA
CCTTGTCCTGGAATAAAAAATAAGAAAGAACGTTCTATACGATGGTTGCT
AGACTATAGTGTGATTCTTGAGGATCAGCTCCAAGCAATTGCTAAAGCCT
CTTTGCAAGGCTCCATAAAGGTTCTCATTCCAGGAGTGTCTGACGTTTCT
GAGATTATAGAAGTCAAAAAGAAATGGGAGACCATCCGGACGAGGTTCCC
TAAAGGCCATAAGGTTTCTTGGGGGACTATGATAGAATTTCCTTCTGCAG
TTTGGATGATTGAAGAGATCCTTCCTGAATGTGATTTTCTCTCTATAGGG
ACGAATGACCTTGTCCAATATACTTTGGGAATTTCCAGGGAATCCGCTCT
TCCTAAACATCTAAATGTAACTTTGCCCCCAGCAGTGATCCGCATGATTC
ACCATGTACTTCAAGCTGCGAAGCAAAATCAGGTTCCTGTTAGCATTTGT
GGAGAGGCCGCAGGGCAGCTCAGTCTGACTCCTTTATTTATAGGCCTAGG
AGTTCAAGAGCTCTCAGTAGCTATGCCTGTAATCAATAGACTTCGCAATC
ATATCGCCCTGCTAGAGTTGAACTCCTGCCTTGAAATTACAGAAGCCCTT
TTACAAGCTAAAACATGCTCTGAAGTTGAAGAACTTTTAAATAGAAACAA
CAAAATCACATCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy