Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR30 IGR27 IGR29 IGR31 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0036 CPn0041 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0036 CPn0041 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0036 CPn0041 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ptsH, - CPn0037 ptsH, - CPn0037
* Calculated from Protein Sequence

Gene ID: CPn0036

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
51002

Gene Stop:
51799

Gene Length:
798

Molecular Weight*:
31689

pI*:
5.10

Net Charge*:
-10.33

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0036 is orthologously related to CT338, a hypothetical protein: residues 132-261 are 46% similar to residues 24-152 of CT338.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
183  
265

PDB Hit:


Gene Protein Sequence:
MKKPDNDSTFDVRSFFPFDVLCIEQLRKEMSWEVVSAKIPRLPRGWYELM
GLSKEDRIDFCLDFWCSVLGIEHKESPSICRFFSLLETIEVYIYRLEKEP
YQLKMFYVFRDGRCGFQGEPPLLDFLGHHRLPPLGDRHYEKFFSIHNGFG
KWEDEGIFPMRSLAKVQQKLRQQLVVMNKMQAEDNCYSLGIFPFYGYEEP
FAYQSFFFDPEIRRDLPSPNVLLNEESLEHRSLETIELLHLSKSYYPSFL
SWLENYLHSEEVYNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACCTGACAACGATTCCACATTTGATGTTCGCTCTTTCTTTCC
CTTCGATGTGTTATGTATAGAGCAGTTGCGCAAGGAAATGTCTTGGGAAG
TGGTTTCAGCGAAGATCCCGCGTCTTCCTCGAGGGTGGTACGAGCTCATG
GGACTATCAAAAGAAGATCGTATAGATTTTTGCTTAGACTTCTGGTGTTC
CGTACTAGGGATTGAGCATAAAGAATCTCCAAGTATTTGTCGTTTTTTTT
CTTTACTAGAGACCATTGAAGTTTACATCTATCGCTTGGAAAAAGAACCT
TATCAACTAAAGATGTTTTATGTATTCCGTGATGGTCGTTGTGGGTTTCA
AGGAGAGCCTCCTCTTCTAGATTTTTTAGGGCATCATAGGCTGCCTCCTT
TAGGGGACCGCCATTACGAGAAATTTTTCTCTATTCATAATGGATTCGGG
AAATGGGAGGATGAGGGGATTTTCCCCATGAGGTCTTTAGCAAAGGTACA
ACAAAAATTACGTCAGCAGCTCGTTGTAATGAATAAGATGCAGGCGGAAG
ATAATTGTTATTCTTTAGGTATCTTTCCTTTTTATGGCTATGAAGAGCCT
TTTGCTTATCAGAGTTTCTTTTTTGATCCTGAAATACGCAGAGACCTTCC
TTCTCCGAATGTGTTGTTAAATGAAGAGAGCTTGGAGCATCGAAGCTTAG
AAACTATTGAGTTGTTGCATCTGTCTAAGAGCTATTATCCTTCTTTCCTC
TCGTGGTTGGAGAACTATCTACATAGTGAGGAGGTGTATAATGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy