Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR25 IGR30 IGR27 IGR29 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0036 dnaJ, - CPn0032 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0036 dnaJ, - CPn0032 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ybaB, - CPn0039 CPn0034 dnaX, - CPn0040 CPn0035 CPn0036 dnaJ, - CPn0032 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ptsH, - CPn0037 ptsH, - CPn0037
* Calculated from Protein Sequence

Gene ID: CPn0035

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (basic)

Gene Start:
51029

Gene Stop:
49566

Gene Length:
1464

Molecular Weight*:
55228

pI*:
9.00

Net Charge*:
20.65

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0035 is orthologously related to CT339, a conserved hypothetical protein (basic): residues 17-466 are 38% similar to CT339. CPn0035 is weakly similar to TP0336, a probable ComE protein in T. pallidum: residues 174-430 are 28% similar to residues 259-502 of TP0336. No similarities to M. genitalium or U. urealyticum sequences.



COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 207 to 467 (E-value = 7.8e-75) place CPn0035 in the Competence family which is described as Competence protein (PF03772)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
53  
70
transmembrane  
76  
93
transmembrane  
233  
257
transmembrane  
262  
284
transmembrane  
304  
328
transmembrane  
333  
351
transmembrane  
356  
380
transmembrane  
393  
417
transmembrane  
449  
470

PDB Hit:


Gene Protein Sequence:
MWNRCQVFSSFFFRYPISSWLIRLRASCECFQQRHPIFLCGLYWLAGITS
RGHPECSALILIFLGMFLPRNPKQWLPLASAWIISLMLTPAPFLHDGPIS
GTFVIHHAGGQGTYYGEALCIQTPCGKRAHHLSCQILSESRLELKKVYEL
EGTLHHTSQIVFKSNACYKEIPRSRFYIMKEKCRESSCHFLNHRFPSSEV
GPFASSLLLGTPLPQNLRDLFRQKGLSHLFAISGWHFSLCATTLWMLCAL
LPLKIKKILSFIVLTSLACIFPMSLSVWRSWISVTLLCFSWCFSGSCSGL
NRLGAGFILCSIFFSPFSPTFVLSFLATLGILLFFPKIFSFLYTPWTQFL
SPFWLYPIRYLAMTLAISLSAQLFIVLPIMQYFGSLPLEGLLYNLIVPFT
ILPIIVFLIATIILPCCSPITEALIQGFLSHPWLHNPNILKTLSFAPVPP
WMLTLASLILFFIGILRTNVSPYASISATSYRFIETL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGAATCGTTGTCAGGTTTTTTCATCTTTTTTCTTTCGCTATCCCAT
AAGCTCTTGGCTCATTCGATTACGCGCCTCTTGTGAGTGCTTCCAACAAA
GACATCCTATTTTCTTATGTGGGCTCTATTGGCTTGCTGGCATCACATCC
CGTGGCCACCCAGAATGTAGTGCTCTGATTCTTATTTTCTTAGGAATGTT
CCTTCCTCGCAACCCTAAACAATGGCTCCCTTTAGCAAGTGCTTGGATCA
TTTCTTTGATGTTAACTCCTGCGCCATTCCTCCATGACGGCCCTATATCA
GGGACTTTTGTGATTCACCACGCAGGGGGGCAAGGAACCTACTACGGAGA
AGCTCTTTGTATTCAGACGCCCTGTGGGAAAAGAGCCCACCACCTCTCGT
GTCAAATTCTATCAGAATCCCGTTTAGAGCTTAAAAAGGTTTACGAGCTC
GAAGGGACACTACATCATACATCTCAAATTGTTTTTAAGTCTAATGCTTG
CTACAAAGAAATTCCTAGGTCTAGGTTCTATATCATGAAAGAGAAATGCC
GAGAATCTAGCTGCCATTTCCTGAACCATAGGTTTCCCTCTTCTGAGGTA
GGCCCCTTTGCTTCGAGTCTTCTGCTAGGAACTCCCCTTCCTCAAAATCT
CAGAGACCTCTTCAGACAAAAAGGGTTATCTCATCTCTTTGCTATCTCGG
GCTGGCATTTCTCTCTGTGTGCTACTACTCTCTGGATGCTCTGTGCTCTT
CTTCCTTTAAAAATCAAAAAAATCTTAAGCTTCATTGTTCTGACTTCTCT
AGCCTGTATTTTCCCTATGTCTCTCTCGGTATGGCGCTCTTGGATCTCCG
TAACCCTACTTTGTTTTTCATGGTGTTTTTCTGGGTCCTGTTCGGGGCTA
AATCGTCTAGGCGCAGGCTTTATTTTATGTTCTATCTTTTTTTCGCCCTT
CTCTCCTACCTTTGTTTTAAGCTTCTTAGCGACGTTGGGGATTCTACTCT
TTTTCCCGAAGATCTTTTCCTTTCTCTACACCCCTTGGACTCAGTTTCTC
TCTCCATTTTGGTTGTATCCTATCCGCTATCTTGCCATGACTTTGGCAAT
TTCACTATCGGCACAACTCTTTATTGTTCTGCCAATCATGCAGTACTTTG
GGAGCTTACCCCTTGAGGGTCTCCTCTATAATCTCATTGTTCCTTTTACC
ATTCTCCCCATCATTGTTTTCCTCATTGCAACAATCATCTTGCCATGTTG
CTCCCCTATCACCGAAGCGCTTATCCAGGGATTCCTCTCACATCCTTGGC
TACACAACCCCAATATCCTAAAGACTCTTTCCTTTGCTCCTGTCCCTCCT
TGGATGCTTACCTTAGCTTCTCTTATTTTATTCTTCATTGGAATTTTACG
CACAAACGTCTCCCCCTATGCATCAATTTCTGCGACTTCTTATCGCTTCA
TCGAAACCCTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy