Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR24 IGR25 IGR27 IGR22 IGR23 CPn0034 CPn0035 rs21, - CPn0031 gcp_1, - CPn0030 CPn0036 dnaJ, - CPn0032 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 CPn0034 CPn0035 rs21, - CPn0031 gcp_1, - CPn0030 CPn0036 dnaJ, - CPn0032 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 CPn0034 CPn0035 rs21, - CPn0031 gcp_1, - CPn0030 CPn0036 dnaJ, - CPn0032 ptsI, - CPn0038 pdhAB,odbA  odbB, - CPn0033 ptsH, - CPn0037 ptsH, - CPn0037
* Calculated from Protein Sequence

Gene ID: CPn0034

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
49457

Gene Stop:
48207

Gene Length:
1251

Molecular Weight*:
46062

pI*:
7.20

Net Charge*:
1.00

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
This is a C. pneumoniae-specific protein with no similarities to a known sequence in any other organism.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
182

PDB Hit:


Gene Protein Sequence:
MAEISTPSLPDSSIVSQKTPPVPDPDSSPDHIPTIPTQAPFKPQRKKETP
SSIVNAIAFAILAFLSCLGGVFAICLGCSLEITMPLFILTAVFIAFTLLY
FIHYLEKPKIPEPLPTPPPSPTLRAPTLTPEIPAPAPGIPLPPTLPKVDR
TKLTCNPDIHYPSTYDPKACFSLLKQLFSLDPETRPEDRKYSNKLASILL
RSKEKSGFRFHCFKGHFSHDKILNKKSGAVVISSHSSMDFSTTLGRAFAV
TTCLQRSCWEKIKNNIPTPEKHLPIGSCVSGPWDVEEGAQLYTSHLIVIN
PPTLETLIKEKMRRAITLKDFSMKEAFTNLVLAYLQCFDICIEHNLESVQ
LEVFGLNNLSADQEEFTTWESCCHLALLESVRILLASKEEYALSNVSVNS
ISQVPLQTACRALFLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGGAAATATCGACTCCATCTTTACCCGACTCCTCTATTGTATCCCA
GAAGACACCGCCTGTTCCGGATCCAGATTCTTCTCCTGACCATATCCCTA
CAATCCCCACGCAGGCACCTTTTAAACCTCAACGCAAGAAAGAAACTCCA
TCTTCAATAGTCAACGCAATTGCTTTTGCCATTTTAGCATTCCTATCTTG
CCTAGGGGGAGTTTTTGCCATTTGCCTAGGGTGTTCCCTAGAGATCACCA
TGCCTCTATTCATACTTACCGCAGTCTTTATTGCTTTTACGTTGTTGTAT
TTTATACACTACCTAGAAAAACCTAAGATTCCTGAGCCACTCCCCACTCC
TCCACCCTCACCAACTCTAAGAGCACCCACACTAACTCCAGAAATACCCG
CGCCAGCTCCAGGAATACCCTTACCTCCAACTCTACCTAAAGTCGATAGA
ACAAAACTGACCTGCAATCCTGATATACATTATCCCTCTACGTATGATCC
TAAGGCTTGTTTTTCGTTACTCAAGCAGCTATTCTCTCTAGATCCAGAAA
CCAGACCCGAAGATCGTAAGTATTCCAACAAGCTAGCAAGTATTCTCCTG
AGATCTAAAGAAAAATCTGGATTCCGTTTTCACTGCTTTAAAGGACATTT
TTCTCATGATAAAATTCTAAATAAAAAATCAGGGGCTGTTGTTATCTCTT
CACATTCTAGCATGGATTTCTCCACAACATTAGGAAGAGCGTTTGCTGTT
ACAACATGTTTACAAAGGAGCTGCTGGGAAAAGATCAAAAACAACATTCC
CACTCCAGAAAAACACTTGCCTATAGGTTCATGCGTTTCTGGCCCTTGGG
ATGTAGAAGAGGGCGCGCAACTGTACACCTCTCATCTGATTGTTATCAAT
CCCCCTACATTAGAAACTCTCATTAAGGAAAAAATGCGCCGCGCAATTAC
ATTGAAAGATTTTAGTATGAAAGAGGCATTTACTAATTTAGTACTGGCTT
ATTTGCAATGCTTTGATATCTGTATTGAGCACAATCTTGAAAGTGTACAG
TTAGAAGTTTTTGGATTAAATAACCTCAGCGCAGATCAAGAGGAATTTAC
TACATGGGAGAGTTGTTGCCATCTTGCTCTTTTAGAATCCGTGCGCATTT
TATTAGCATCCAAAGAAGAGTACGCACTCTCTAATGTTTCAGTAAATAGC
ATCTCCCAAGTACCTCTACAAACAGCGTGTCGGGCTCTCTTTTTGAATTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy