Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR24 IGR25 IGR21 IGR27 IGR22 IGR23 IGR20 CPn0029 CPn0028 CPn0034 CPn0035 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0029 CPn0028 CPn0034 CPn0035 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0028 CPn0034 CPn0035 lon, - CPn0027 CPn0029 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033
* Calculated from Protein Sequence

Gene ID: CPn0032

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaJ  

Definition:
heat shock protein J

Gene Start:
44923

Gene Stop:
46101

Gene Length:
1179

Molecular Weight*:
42097

pI*:
7.30

Net Charge*:
1.29

EC:
 

Functional Class:
cellular processes; chaperones  

Pathway: pathway table

Secondary Evidence:
"TRANSCRIPTIONAL ORGANIZATION AND REGULATION OF THE DNAK AND GROE OPERONS OF CHLAMYDIA-TRACHOMATIS." 1996. TAN M, WONG B, ENGEL JN. JOURNAL OF BACTERIOLOGY 178(23): 6983-6990.

Comment:
DnaJ is a chaperone induced by heat shock (regulated by HtpR regulatory protein) that interacts with DnaK, promoting
the ATPase activity of the latter. DnaJ and DnaK interact to disassemble a protein complex at the lambda phage origin of replication. DnaJ is believed to be a homodimer.

Blast Summary:  PSI-Blast Search
CPn0032 is orthologously related to CT341: residues 1-392 of CPn0032 are 84% similar to residues 1-392 CT341, a predicted DnaJ protein from C. trachomatis.
CPn0032 is also similar to TP0217, TP0217A, UU407, MG019, TP0098, MG200, all heat shock proteins.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 67 (E-value = 1.7e-42) place CPn0032 in the DnaJ family which is described as DnaJ domain (PF00226)
Residues 148 to 228 (E-value = 5.7e-22) place CPn0032 in the DnaJ_CXXCXGXG family which is described as DnaJ central domain (4 repeats) (PF00684)
Residues 241 to 365 (E-value = 2.2e-54) place CPn0032 in the DnaJ_C family which is described as DnaJ C terminal region (PF01556)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
70  
133

PDB Hit:


Gene Protein Sequence:
MDYYSILGISKTASAEEIKKAYRKLAVKYHPDKNPGDAAAEKRFKEVSEA
YEVLSDPQKRDSYDRFGKDGPFAGAGGFGGAGGMGNMEDALRTFMGAFGG
EFGGGSFFDGLFGGLGEAFGMRSDPAGARQGASKKVHINLTFEEAAHGVE
KELVVSGYKSCETCSGQGAVNPQGIKSCERCKGSGQVVQSRGFFSMASTC
PECGGEGRIITDPCSSCRGQGRVKDKRSVHVHIPAGVDSGMRLKMEGYGD
AGQNGAPSGDLYVFIDVESHPVFERRGDDLILELPIGFVDAALGMKKEIP
TLLKTEGSCRLTVPEGIQSGTILKVRNQGFPNVHGKGRGDLLVRISVETP
QNLSEEQKELLRTFASTEKAENFPKKRSFLDKIKGFFSDFTV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTATTATTCAATTTTAGGCATTTCTAAAACTGCTTCCGCAGAAGA
AATTAAAAAAGCCTATCGCAAATTAGCTGTTAAATATCATCCGGATAAAA
ATCCTGGGGATGCTGCAGCGGAAAAACGCTTCAAAGAAGTTTCCGAAGCT
TATGAAGTTCTCAGTGATCCTCAGAAGCGCGACTCTTACGATCGTTTCGG
TAAGGACGGTCCTTTTGCTGGAGCCGGTGGCTTTGGTGGCGCTGGAGGCA
TGGGGAACATGGAAGATGCCTTGCGCACTTTCATGGGAGCCTTTGGCGGA
GAGTTCGGAGGTGGAAGCTTCTTTGATGGTCTTTTTGGTGGGCTTGGTGA
AGCTTTTGGAATGCGCTCAGATCCTGCAGGCGCTCGTCAAGGAGCCAGTA
AGAAAGTTCATATTAATTTGACTTTTGAAGAAGCAGCTCATGGTGTTGAG
AAGGAACTTGTAGTTTCTGGATATAAATCTTGTGAAACCTGTTCTGGTCA
AGGAGCTGTAAACCCTCAAGGGATTAAATCCTGCGAACGTTGCAAAGGTT
CGGGACAAGTGGTACAGAGTCGTGGATTTTTCTCCATGGCCTCTACATGT
CCAGAATGCGGTGGCGAAGGCCGTATTATCACAGACCCTTGTTCTTCATG
TCGCGGCCAAGGAAGAGTTAAAGATAAACGTAGTGTCCATGTGCATATCC
CCGCAGGTGTGGATTCTGGAATGCGCTTGAAGATGGAAGGCTATGGAGAT
GCAGGCCAAAATGGAGCTCCCTCCGGAGATCTCTATGTCTTTATTGATGT
AGAGTCTCATCCCGTATTTGAGCGTCGTGGAGATGACTTGATCCTAGAGC
TTCCCATTGGTTTTGTAGATGCTGCTCTCGGTATGAAGAAAGAAATTCCT
ACGTTATTGAAGACAGAAGGATCGTGTCGTCTTACGGTTCCTGAAGGAAT
TCAAAGTGGAACCATTTTAAAAGTAAGAAATCAGGGCTTTCCTAATGTTC
ATGGGAAAGGTCGTGGAGATCTTTTAGTTCGCATTTCTGTAGAAACTCCT
CAAAATTTATCAGAAGAGCAAAAAGAACTTTTACGTACTTTTGCTTCTAC
AGAAAAAGCAGAGAACTTTCCTAAGAAGCGTAGCTTTTTAGATAAAATCA
AAGGTTTTTTTTCTGACTTCACAGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy