Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR24 IGR25 IGR21 IGR27 IGR22 IGR23 IGR20 CPn0029 CPn0028 CPn0034 CPn0035 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0029 CPn0028 CPn0034 CPn0035 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0028 CPn0035 lon, - CPn0027 CPn0029 CPn0034 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033
* Calculated from Protein Sequence

Gene ID: CPn0031

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs21  

Definition:
30S ribosomal protein S21

Gene Start:
44711

Gene Stop:
44887

Gene Length:
177

Molecular Weight*:
6618

pI*:
11.70

Net Charge*:
15.22

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
The 50S ribosomal L11 protein binds to 23S
ribosomal RNA and is translationally
regulated by L1 (see CPn0078).

Blast Summary:  PSI-Blast Search
Several weak hits in gapped BLAST to RS21 seqences,e.g., residues 1-58 are 41%, 40% similar to RS21_PSEPU and RS21_ECOLI, respectively; residues 1-54 are 42%,44% similar to RS21_BACSU and RS21_BACST, respectively.

BLAST reveals no significant similarity to M.
genitalium, T. pallidum, or U. urealyticum.

CPn0031 is orthologously related to CT342:
residues 1-58 are 93% similar to that of CT342.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 56 (E-value = 1.4e-09) place CPn0031 in the Ribosomal_S21 family which is described as Ribosomal protein S21 (PF01165)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
58

PDB Hit:


Gene Protein Sequence:
MPSVKVRVGEPVDRALRILKKKIDKEGILKAAKSHRFYDKPSVKKRAKSK
AAAKYRSR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCAGTGTTAAAGTTCGAGTTGGAGAGCCTGTAGATCGTGCTCTGCG
CATCTTAAAAAAGAAAATAGATAAAGAAGGGATTTTAAAAGCTGCTAAAT
CCCATCGCTTTTATGACAAGCCTTCTGTCAAGAAACGAGCTAAATCTAAG
GCTGCGGCTAAGTATCGTAGTCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy