Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR24 IGR25 IGR21 IGR22 IGR19 IGR23 IGR20 CPn0029 CPn0028 CPn0026 CPn0034 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0029 CPn0028 CPn0026 CPn0034 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0028 CPn0026 CPn0034 lon, - CPn0027 CPn0029 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033
* Calculated from Protein Sequence

Gene ID: CPn0030

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcp_1  

Definition:
O-sialoglycoprotein endopeptidase, predicted

Gene Start:
43891

Gene Stop:
44532

Gene Length:
642

Molecular Weight*:
23646

pI*:
5.70

Net Charge*:
-3.18

EC:
 

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Comment:
O-sialoglycoprotein endopeptidase is a neutral metalloprotease that cleaves specifically o-sialoglycoproteins such as glycophorin A (cleaving, specifically,
the 31-arg-|-asp-32 bond). O-sialoglycoprotein endopeptidase will not cleave unglycosylated proteins, desialylated glycoproteins or glycoproteins that are only N-glycosylated.
Zinc is probably a cofactor.
This protein is probably extracellular, however it is not secreted through the conventional secretory pathway since it lacks a signal sequence.
This protein is a member of the peptidase family M22; also known as the glycoprotease family.


Blast Summary:  PSI-Blast Search
CPn0030 is orthologously related to CT343: residues 4-213 of CPn0030 are 54% similar to residues 2-210 of CT343, a predicted sialoglycoprotease from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
84  
146

PDB Hit:


Gene Protein Sequence:
MYFYKYVIIDTSGYYPFLACVDNQQVLEHWSLPVGPDLGIVLEFLFKSKN
LSFQGVAVALGPGNFSATRIGISFAQGLAMAKNVPLLGYSSLEGYLLSKD
EKKALMLPLGKRGGVLTLSSEIPEEGLNEKRRGVGPGALLSYEEASDYCV
AHGYYHVISPNPQLFASSFSDKITVEEVAPSVEQIRRHVISQFMFVEYDK
QLSPDYRSYSCIF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACTTCTATAAGTATGTTATCATAGATACTTCTGGATACTATCCATT
CTTAGCTTGTGTGGATAATCAACAAGTGCTGGAGCATTGGTCTTTGCCAG
TCGGTCCAGATCTTGGAATTGTTTTAGAGTTTCTTTTTAAAAGTAAAAAT
CTCTCTTTTCAGGGAGTTGCTGTGGCTCTAGGTCCAGGAAACTTTTCTGC
AACACGGATAGGGATTTCTTTCGCTCAAGGATTGGCAATGGCAAAGAATG
TGCCTTTGCTAGGATATAGCTCTTTGGAAGGATACTTATTATCTAAAGAT
GAAAAAAAAGCTTTAATGCTTCCTTTGGGGAAACGTGGAGGCGTCCTGAC
TTTAAGCTCTGAGATTCCTGAAGAGGGCTTGAATGAAAAAAGGAGAGGGG
TGGGGCCGGGAGCTTTGCTCTCTTATGAAGAGGCCTCTGATTACTGCGTT
GCTCATGGATATTATCATGTGATTTCTCCTAATCCGCAGCTCTTTGCGAG
CAGTTTTTCTGATAAGATCACCGTAGAAGAAGTTGCTCCTTCGGTAGAAC
AGATCCGCAGGCACGTGATTTCTCAATTCATGTTTGTAGAATATGACAAG
CAGCTCTCTCCTGATTACCGTAGCTATTCATGTATTTTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy