Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR26 IGR24 IGR25 IGR21 IGR22 IGR19 IGR18 IGR23 IGR20 CPn0029 CPn0028 CPn0026 CPn0025 CPn0034 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0029 CPn0028 CPn0026 CPn0025 CPn0034 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0028 CPn0025 CPn0034 lon, - CPn0027 CPn0029 CPn0026 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033
* Calculated from Protein Sequence

Gene ID: CPn0029

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
43755

Gene Stop:
43387

Gene Length:
369

Molecular Weight*:
14297

pI*:
10.70

Net Charge*:
8.94

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
81

PDB Hit:


Gene Protein Sequence:
MNDGLRFCYSYILLRPMLLDSSLLRKGGQELLKKFQIKLRTTSIKSSLIS
LRQQLGKREATQSDILYGTSRFQYLNSFEIEDPRIPPTMAAQLQEITWSR
SVMELKIKFYVYLNSERNKTKP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGATGGGTTGCGATTTTGTTACTCCTATATACTTTTACGCCCAAT
GCTACTCGATTCTTCCTTGCTTAGGAAAGGGGGTCAGGAACTCTTGAAAA
AATTTCAAATCAAATTGAGAACTACTTCTATTAAGAGTAGTTTAATAAGC
TTACGCCAACAACTAGGCAAACGAGAAGCTACCCAATCCGATATTCTCTA
TGGGACGTCCCGTTTTCAATATCTGAATTCATTTGAGATTGAAGATCCAA
GAATCCCCCCAACTATGGCCGCACAATTACAAGAGATTACTTGGAGTCGT
TCTGTTATGGAACTGAAGATCAAATTTTATGTTTATCTAAATTCTGAGAG
AAACAAGACTAAGCCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy