Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR24 IGR25 IGR21 IGR22 IGR19 IGR18 IGR23 IGR20 CPn0029 CPn0028 CPn0026 CPn0025 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0029 CPn0028 CPn0026 CPn0025 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033 CPn0028 CPn0026 CPn0025 lon, - CPn0027 CPn0029 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 pdhAB,odbA  odbB, - CPn0033
* Calculated from Protein Sequence

Gene ID: CPn0028

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
43325

Gene Stop:
42540

Gene Length:
786

Molecular Weight*:
29519

pI*:
10.00

Net Charge*:
9.06

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
48  
65
transmembrane  
75  
99

PDB Hit:


Gene Protein Sequence:
MFLQFFHPIVFSDQSLSFLPYLGKSSGIIEKCSNIVEHYLHLGGDTSVII
TGVSGATFLSVDHALPISKSEKIIKILSYILILPLILALFIKIVLRIILF
FKYRGLILDVKKEDLKKTLTPDQENLSLPLPSPTTLKKIHALHILVRSGK
TYNELIQEGFSFTKITDLGQAPSPKQDIGFSYNSLLPNFYFHSLVSVPNI
SGEERALNYHKEQQEEMAVKLKTMQACSFVFRSLHLPSMQTKDKKAGFGL
LTFFPWKIYPL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTCTTCAGTTTTTTCATCCTATAGTCTTCTCGGATCAGTCCTTATC
TTTTCTTCCTTACCTAGGAAAAAGCTCTGGCATTATTGAAAAATGTTCCA
ATATCGTTGAACACTATTTACATTTGGGAGGAGACACTTCTGTTATCATC
ACAGGAGTTTCTGGAGCTACCTTTCTATCTGTTGATCATGCCCTCCCAAT
CTCGAAATCTGAAAAAATAATAAAAATTCTCTCCTATATTTTAATTCTTC
CTCTGATTCTAGCTCTCTTTATTAAGATCGTTTTACGCATTATCTTATTC
TTCAAGTATCGTGGTCTAATCCTAGATGTTAAGAAGGAGGATTTGAAAAA
AACACTTACACCTGACCAAGAAAACCTCAGTCTTCCTTTACCATCTCCTA
CAACATTAAAGAAAATTCATGCGCTACACATTTTAGTGCGTTCTGGAAAA
ACCTATAACGAGCTTATACAAGAAGGGTTTTCTTTCACTAAAATCACAGA
TCTTGGTCAAGCTCCTTCACCAAAGCAAGATATTGGCTTCTCTTATAATT
CCCTTCTCCCTAACTTCTATTTTCATTCCTTGGTATCTGTTCCAAATATT
TCAGGCGAGGAACGGGCTCTTAATTATCATAAAGAACAACAAGAGGAAAT
GGCTGTTAAATTAAAAACAATGCAAGCGTGTTCTTTTGTCTTCCGATCCC
TGCATTTACCTTCAATGCAAACGAAGGACAAAAAGGCTGGATTTGGACTA
CTGACGTTTTTCCCTTGGAAAATCTACCCCCTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy