Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR24 IGR16 IGR21 IGR17 IGR22 IGR19 IGR18 IGR23 IGR20 CPn0029 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 CPn0029 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 lon, - CPn0027 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 lon, - CPn0027 CPn0029 rs21, - CPn0031 gcp_1, - CPn0030 dnaJ, - CPn0032
* Calculated from Protein Sequence

Gene ID: CPn0027

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lon  

Definition:
Lon ATP-dependent protease

Gene Start:
42234

Gene Stop:
39775

Gene Length:
2460

Molecular Weight*:
92238

pI*:
8.80

Net Charge*:
7.34

EC:
3.4.21.-  

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Comment:
Lon protease degrades misfolded and abnormal proteins inside the cell. This proteolysis serves to limit the availability of critical regulatory proteins through degradation.
The proteolytic activity of Lon is coupled to the ATPase activity of its regulatory subunits/domains.

For review, see, "PROTEASES AND THEIR TARGETS IN ESCHERICHIA-COLI. 1996. GOTTESMAN S. ANNUAL REVIEW OF GENETICS 30: 465-506.

Blast Summary:  PSI-Blast Search
CPn0027 is orthologously related to CT344: residues 1-816 of CPn0027 are 86% similar to residues 1-817 of CT344, a predicted LON protease LA from C. trachomatis.
CPn0027 is also similar to TP0524, UU348, MG239, all predicted ATP-dependent proteases.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 42 to 238 (E-value = 1e-24) place CPn0027 in the LON family which is described as ATP-dependent protease La (LON) domain (PF02190)
Residues 388 to 583 (E-value = 2.7e-49) place CPn0027 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 612 to 817 (E-value = 3.4e-102) place CPn0027 in the Lon_C family which is described as Lon protease (S16) C-terminal proteolytic domain (PF05362)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
48
coil-coil  
140  
174
coil-coil  
250  
283
non-globular  
337  
430
non-globular  
714  
819

PDB Hit:


Gene Protein Sequence:
VDSTTNSDSPILDPNPEDVEKLLDESEEESEDQSTERLLPSELFILPLNK
RPFFPGMAAPILIESGPYYEVLKVLAKSSQKYIGLVLTKKENADILKVSF
NQLHKTGVAARILRIMPIEGGSAQVLLSIEERIRIIEPIKDKYLKARVSY
HADNKELTEELKAYSISIVSVIKDLLKLNPLFKEELQIFLGHSDFTEPGK
LADFSVALTTATREELQEVLETTNMHDRIDKALILLKKELDLSRLQSSIN
QKIEATITKSQKEFFLKEQLKTIKKELGLEKEDRAIDIEKFSERLRKRHV
PDYAMEVIQDEIEKLQTLETSSAEYTVCRNYLDWLTIIPWGIQSKEYHDL
KKAEIVLNKDHYGLDEIKQRILELISVGKLSKGLKGSIICLVGPPGVGKT
SIGRSIAKVLHRKFFRFSVGGMRDEAEIKGHRRTYIGAMPGKMVQALKQS
QAMNPVIMIDEVDKIGASYHGDPASALLEVLDPEQNKDFLDHYLDVRVDL
SNVLFILTANVLDTIPDPLLDRMEILRLSGYILEEKLQIAKKYLVPKARK
EIGLTASEVNFQPEALKYMINNYAREAGVRTLNGNIKKVLRKVALKIVQN
QEKPKSKKITFKISSKNLQTYLGKPIFSSDRFYESTPVGVATGLAWTSLG
GATLYIESVQVSSLKTDMHLTGQAGEVMKESSQIAWTYLHSALHRYAPGY
TFFPKSQVHIHIPEGATPKDGPSAGITMVTSLLSLLLETPVVNNLGMTGE
ITLTGRVLGVGGIREKLIAARRSRLNILIFPEDNRRDYEELPAYLKTGLK
IHFVSHYDDVLKVAFPKLK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGACTCTACAACCAATAGCGACTCCCCCATCTTAGATCCAAATCCAGA
AGATGTTGAAAAGCTTTTAGATGAATCTGAAGAGGAATCCGAAGATCAGT
CTACGGAGCGTTTGCTGCCTTCTGAGTTATTTATCCTGCCATTAAATAAA
CGACCTTTTTTCCCCGGAATGGCGGCTCCCATTCTTATTGAGTCAGGTCC
TTATTATGAAGTATTAAAGGTTTTAGCGAAGTCGTCTCAAAAATATATTG
GTCTTGTCTTAACCAAAAAAGAGAACGCCGATATTTTAAAAGTGAGCTTC
AACCAGCTGCATAAAACTGGAGTTGCCGCAAGAATCCTCCGTATCATGCC
AATCGAGGGTGGCAGTGCTCAAGTTCTTTTAAGCATTGAAGAGCGTATTC
GGATTATAGAACCCATTAAAGACAAATATCTTAAAGCTCGAGTTTCCTAT
CATGCGGACAATAAAGAGCTTACAGAAGAGCTAAAAGCGTACTCTATTAG
TATTGTCTCTGTCATCAAAGACCTTTTAAAACTAAATCCTCTCTTTAAAG
AAGAACTACAAATTTTTCTTGGTCATTCGGATTTTACTGAACCAGGCAAG
CTTGCGGATTTCTCTGTTGCTTTAACAACAGCAACTCGGGAAGAGCTCCA
AGAGGTCTTAGAGACCACCAACATGCATGATCGCATTGATAAGGCACTGA
TCTTACTAAAAAAGGAATTAGACTTAAGCCGCCTCCAGAGCAGCATTAAT
CAAAAAATTGAAGCTACGATTACAAAAAGCCAAAAGGAATTCTTCTTAAA
AGAGCAGTTAAAAACGATTAAAAAAGAACTGGGGTTAGAGAAAGAAGACC
GCGCTATTGATATAGAGAAGTTTTCGGAAAGGCTAAGAAAACGCCATGTT
CCTGATTATGCTATGGAAGTGATTCAAGATGAAATTGAAAAACTTCAGAC
TTTAGAAACTTCTTCGGCGGAATATACCGTATGCCGCAATTACCTGGATT
GGCTGACAATCATTCCTTGGGGCATACAAAGTAAAGAATACCATGACTTA
AAGAAAGCAGAAATCGTCCTGAACAAGGATCACTATGGCCTTGATGAGAT
TAAACAACGCATTCTCGAGTTAATCAGTGTAGGTAAGCTTTCCAAAGGAT
TAAAAGGAAGTATCATCTGTCTTGTAGGCCCTCCAGGAGTTGGGAAAACA
AGCATAGGGCGCAGCATTGCTAAAGTCCTGCATAGAAAGTTCTTCCGTTT
CTCAGTAGGAGGCATGCGTGATGAGGCCGAGATCAAGGGGCATCGCCGCA
CCTATATTGGGGCAATGCCAGGAAAAATGGTCCAGGCGCTCAAGCAAAGC
CAAGCTATGAATCCTGTGATTATGATTGATGAGGTAGATAAAATTGGTGC
GAGTTATCATGGAGATCCTGCCTCTGCCTTATTAGAGGTTTTAGATCCTG
AGCAAAACAAAGATTTTCTTGATCATTATTTAGACGTACGTGTTGATCTA
TCCAATGTACTATTCATTTTAACTGCCAATGTTCTAGATACCATTCCGGA
TCCTCTTTTAGATCGCATGGAGATTCTCCGACTTTCTGGCTACATTTTAG
AAGAGAAACTTCAAATTGCTAAAAAGTATCTAGTTCCCAAAGCTCGCAAA
GAAATCGGTTTAACAGCAAGCGAAGTGAATTTCCAACCTGAAGCTTTAAA
GTACATGATCAATAACTATGCACGAGAAGCTGGGGTACGTACTCTTAATG
GGAATATCAAAAAAGTATTGAGGAAAGTTGCTTTAAAGATTGTTCAAAAT
CAAGAAAAACCCAAATCTAAGAAGATTACTTTTAAAATCTCTTCGAAAAA
TCTGCAGACCTACTTAGGGAAACCGATATTTTCTAGCGATCGCTTCTATG
AATCCACTCCTGTAGGAGTGGCCACAGGACTTGCCTGGACCTCTTTAGGT
GGAGCAACGTTATATATAGAAAGTGTACAGGTGTCCTCACTCAAAACAGA
CATGCACCTTACAGGTCAGGCTGGGGAAGTAATGAAGGAGTCTTCTCAGA
TTGCTTGGACCTACCTTCACAGTGCTCTCCATCGGTATGCCCCAGGCTAT
ACGTTCTTTCCAAAGTCTCAAGTACATATCCACATTCCTGAGGGAGCCAC
CCCTAAAGACGGTCCTTCTGCAGGAATTACTATGGTGACCTCTCTCCTTT
CGTTGCTGTTGGAAACTCCGGTAGTGAATAATTTGGGAATGACTGGAGAA
ATTACTCTTACAGGTCGTGTTTTAGGTGTAGGAGGCATTCGAGAGAAACT
GATTGCAGCTCGAAGATCACGATTGAACATCTTGATTTTCCCTGAAGACA
ACCGTAGAGACTATGAAGAGCTTCCTGCATATCTGAAAACAGGGTTGAAA
ATACATTTTGTTTCACACTATGATGATGTTCTCAAAGTTGCTTTTCCCAA
GCTAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy