Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR15 IGR16 IGR21 IGR17 IGR22 IGR19 IGR18 IGR20 CPn0029 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 lon, - CPn0027 gcp_1, - CPn0030 CPn0029 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 lon, - CPn0027 gcp_1, - CPn0030 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 lon, - CPn0027 maf, - CPn0022 CPn0021 CPn0029 maf, - CPn0022 gcp_1, - CPn0030
* Calculated from Protein Sequence

Gene ID: CPn0026

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic)

Gene Start:
39625

Gene Stop:
38759

Gene Length:
867

Molecular Weight*:
31887

pI*:
10.60

Net Charge*:
24.08

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0026 is weakly similar to CT345, a hypothetical protein: residues 5-85 are 33% similar to residues 3-82 of CT345.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
36  
60
transmembrane  
67  
84
non-globular  
147  
288

PDB Hit:


Gene Protein Sequence:
MSHLIPSLRNSVTSYFHKPQPIKQAAPSKSIRDICNIAYLIIICVLVVVV
LVGAMLCMFIPSVGIPLCLSSLALLVLLSIFNPCLINWISTKKTKEIAPK
DASESQPTKSASRKGSPQLSPHHDHEPKNFIRTQLEKGVNYVTNKFKSGE
ESPHISDEHHSPRQSKRSSEIESSDESSPELHRKAKGKAPHTATTKESKT
STTESSKKKKKTKHSLHRTTSSIHKRSAPKPMVPSKKRKPVLLKKTVPLP
IEDLEHQSSGNESSDSSSPPPVQRKAILPWFCKQPTDP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCCATCTTATTCCTAGCCTGCGCAACTCAGTGACTTCGTATTTCCA
TAAACCTCAACCGATCAAACAAGCGGCTCCTTCCAAATCGATTCGAGACA
TTTGCAACATTGCTTACCTAATCATTATATGCGTTCTCGTCGTCGTAGTT
CTTGTTGGAGCTATGCTATGCATGTTTATTCCCTCTGTAGGAATTCCTCT
TTGTTTAAGCTCATTGGCACTTCTAGTGCTCTTGAGTATTTTCAATCCGT
GTCTCATTAATTGGATATCCACAAAAAAAACAAAAGAAATTGCCCCAAAA
GATGCCTCTGAATCACAACCTACAAAATCTGCGTCTAGAAAAGGGAGCCC
GCAACTCTCCCCACATCATGACCACGAACCAAAAAACTTCATAAGAACGC
AATTAGAAAAAGGCGTCAACTATGTAACAAACAAATTCAAAAGTGGTGAA
GAGAGTCCTCACATCTCTGATGAACACCATTCACCTAGGCAAAGCAAGCG
TTCTTCTGAAATTGAATCCTCTGATGAATCTTCCCCTGAACTCCATCGCA
AAGCCAAGGGAAAAGCACCTCATACGGCAACTACAAAAGAGTCTAAAACT
TCAACAACAGAAAGCTCAAAGAAGAAGAAGAAAACTAAACACTCCTTACA
TAGAACGACAAGTAGCATACATAAGAGATCAGCACCAAAACCCATGGTTC
CGTCGAAAAAAAGAAAACCTGTGCTATTGAAAAAAACCGTCCCCCTCCCT
ATAGAAGATCTAGAACATCAATCATCAGGCAATGAGAGTTCTGATTCTTC
ATCTCCTCCACCCGTACAACGGAAAGCGATACTCCCTTGGTTCTGCAAGC
AACCGACAGACCCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy