Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR15 IGR16 IGR17 IGR19 IGR18 IGR20 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 lon, - CPn0027 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 lon, - CPn0027 CPn0028 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 lon, - CPn0027 maf, - CPn0022 maf, - CPn0022
* Calculated from Protein Sequence

Gene ID: CPn0025

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (probable hydrolase)

Gene Start:
38604

Gene Stop:
37681

Gene Length:
924

Molecular Weight*:
34886

pI*:
7.60

Net Charge*:
2.85

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible aryl-sulfate sulfohydrolase (elaC)(atsA).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to conserved hypothetical protein sequences; e.g. residues 1-303 are 71% similar to CT346, a conserved hypothetical protein (probable hydrolase); residues 5-298 are 27% similar to TP0819, a conserved hypothetical protein; residues 5-294 are 27% similar to (AP000005) 307aa long hypothetical sulfatase [Pyrococcus horikoshii]; residues 5-301 are 28% similar to Y050_SYNY3; residues 5-293 are 28% similar to (AE000936) conserved protein [Methanobacterium thermoautotrophicum]; and residues 5-294 are 30% similar to ELAC_ECOLI.
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 5-121 are 36% similar to a defined domain of O58883_PYRHO, defined as: PROTEIN CONSERVED INTERGENIC REGION LONG HYDROLASE CHROMOSOME ELAC 307AA RNHB-PGAA.
Residues 133-294 are 32% similar to a defined domain of ELAC_ECOLI, defined as: PROTEIN INTERGENIC REGION CHROMOSOME CONSERVED C3D6.03C II C1D4.10 I SIS2-MTD1.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 21 to 266 (E-value = 1.4e-12) place CPn0025 in the Lactamase_B family which is described as Metallo-beta-lactamase superfamily (PF00753)

PDB Hit:


Gene Protein Sequence:
MSSRELIILGCSSQQPTRTRNQGAYLFRWNGEGLLFDPGEGTQRQFIFAN
IAPTTVNRIFVSHFHGDHCLGLGSMLMRLNLDKVSHPIHCYYPASGKKYF
DRLRYGTIYHETIQVVEHPISEEGIVEDFGSFRIEAQRLQHQVDTLGWRI
TEPDTIKFLPKELESRGIRGLIIQDLIRDQEISIGGSTVYLSDVSYVRKG
DSIAIIADTLPCQAAIDLAKNSCMMLCESTYLEQHRHLAESHFHMTAKQA
ATLAKRAATQKLILTHFSARYLNLDDFYKEASAVFPNVSVAQEYRSYPFP
KNPLLNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTCTAGAGAGTTAATTATTTTAGGGTGCTCGAGCCAACAGCCTAC
ACGAACACGCAATCAAGGAGCCTACCTATTTCGCTGGAATGGTGAGGGTC
TACTTTTTGATCCTGGTGAAGGCACTCAAAGGCAATTCATCTTTGCAAAT
ATTGCTCCTACAACAGTCAATAGAATTTTTGTGAGTCATTTCCATGGAGA
TCATTGTTTGGGTCTAGGCTCCATGTTGATGCGTCTTAACTTGGACAAGG
TTTCGCACCCTATCCATTGCTACTATCCTGCTTCAGGGAAAAAATACTTT
GACCGCTTACGTTATGGAACAATTTATCACGAAACCATCCAGGTGGTGGA
GCATCCAATCTCTGAGGAAGGAATTGTCGAAGATTTTGGTAGTTTTCGTA
TTGAAGCACAGCGACTCCAACACCAAGTAGACACTTTAGGATGGAGAATC
ACGGAACCAGACACTATAAAATTTCTTCCTAAAGAGCTGGAATCTCGAGG
CATTCGTGGTCTGATTATCCAAGATCTTATTCGTGACCAAGAAATTTCGA
TAGGCGGTTCTACGGTATATCTTAGTGATGTTAGCTACGTCCGCAAGGGG
GATAGCATTGCGATTATTGCGGATACTTTGCCTTGCCAAGCTGCTATAGA
TCTCGCAAAAAATAGCTGCATGATGTTGTGTGAAAGCACCTACCTCGAAC
AGCACCGCCATCTTGCTGAGAGCCATTTTCATATGACTGCAAAACAAGCG
GCGACTCTTGCGAAACGTGCCGCAACACAAAAGCTTATTCTCACACACTT
CTCGGCACGTTACTTAAATCTGGATGATTTTTATAAAGAAGCCTCGGCAG
TATTTCCTAATGTGTCCGTAGCACAAGAATATCGCAGCTACCCCTTTCCG
AAAAATCCTCTTCTAAATAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy