Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR14 IGR15 IGR16 IGR17 IGR19 IGR18 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 lon, - CPn0027 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 lon, - CPn0027 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 lon, - CPn0027 maf, - CPn0022 maf, - CPn0022
* Calculated from Protein Sequence

Gene ID: CPn0024

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
xerC  

Definition:
integrase/recombinase XERC-related

Gene Start:
37596

Gene Stop:
36658

Gene Length:
939

Molecular Weight*:
35838

pI*:
10.60

Net Charge*:
22.42

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
In E.coli, this protein is involved in
site-specific (XER) recombination, apparently
catalyzing the cutting and rejoining of
molecules. XERC and XERD proteins act together
in this role. See CPn1024 for the putative XERD
sequence.

Blast Summary:  PSI-Blast Search
CPn0024 is similar to TP0391 and TP0395, both predicted integrase/recombinases in T. pallidum.

CPn0024 is orthologously related to CT347 and they share 64% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0024 is paralogously related to CPn1024, a predicted integrase/recombinase: residues 67-310 are 29% similar to CPn1024.

Pfam Summary:  Pfam Search
Residues 5 to 107 (E-value = 1.1e-13) place CPn0024 in the Phage_integr_N family which is described as Phage integrase, N-terminal SAM-like domain (PF02899)
Residues 129 to 303 (E-value = 1.4e-46) place CPn0024 in the Phage_integrase family which is described as Phage integrase family (PF00589)

PDB Hit:


Gene Protein Sequence:
MIASIYSFLDYLKMVKSASPHTLRNYCLDLNGLKIFLEERGNLAPSSPLQ
LATEKRKVSELPFSLFTKEHVRMYIAKLIENGKAKRTIKRCLSSIKSFAH
YCVIQKILLENPAETIHGPRLPKELPSPMTYAQVEVLMATPDISKYHGLR
DRCLMELFYSSGLRISEIVAVNKQDFDLSTHLIRIRGKGKKERIIPVTSN
AIQWIQIYLNHPDRKRLEKDPQAIFLNRFGRRISTRSIDRSFQEYLRRSG
LSGHITPHTIRHTIATHWLESGMDLKTIQALLGHSSLETTTVYTQVSVKL
KKQTHQEAHPHA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGCCTCTATCTATTCGTTCTTAGACTATTTGAAAATGGTAAAAAG
TGCCTCTCCGCATACATTAAGAAATTATTGTCTAGATCTTAATGGATTGA
AAATTTTTTTAGAGGAACGTGGTAACCTCGCTCCTTCTTCTCCTTTACAG
TTAGCCACAGAGAAGCGCAAAGTCTCTGAACTTCCTTTTTCCTTATTCAC
CAAAGAGCATGTACGCATGTACATCGCGAAACTGATAGAAAATGGCAAAG
CTAAGAGAACAATTAAGCGTTGCCTCTCTTCCATTAAAAGCTTTGCCCAT
TACTGTGTTATTCAAAAGATTCTTTTGGAAAATCCTGCGGAAACTATCCA
CGGACCTCGTCTTCCTAAGGAGCTGCCTTCCCCGATGACCTATGCGCAAG
TTGAAGTGCTGATGGCGACTCCTGACATTTCTAAATATCACGGACTTCGT
GATCGCTGTCTCATGGAGCTGTTCTATAGTTCGGGTTTGAGGATTAGTGA
GATTGTCGCTGTTAATAAACAGGACTTTGATTTGAGTACTCATCTGATTC
GCATCCGTGGGAAAGGGAAAAAAGAAAGGATTATTCCCGTGACATCGAAT
GCCATACAATGGATCCAAATCTACCTGAACCATCCGGATAGAAAGCGTTT
GGAAAAGGATCCTCAAGCCATCTTTCTCAATCGCTTTGGGAGGCGCATTT
CAACACGATCTATTGACAGAAGTTTTCAAGAATATCTTCGACGTTCTGGA
CTTTCAGGGCACATCACCCCCCATACAATCCGTCACACTATAGCCACCCA
TTGGCTAGAGAGTGGTATGGATTTAAAAACAATCCAAGCACTTCTTGGTC
ATAGTTCTTTAGAGACAACAACGGTCTATACGCAAGTCTCTGTAAAGTTA
AAAAAACAGACCCACCAAGAAGCCCATCCCCATGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy